Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

Protect Yourself from Migration Fraud

TotoyOZresidentTotoyOZresident Posts: 1,327Member, Moderator
edited November 2011 in Working in Australia
Protect Yourself from Migration Fraud

People may give you false or misleading information in order to take advantage of your desire to visit or migrate to Australia. Becoming a victim of fraudulent activity could mean you lose your life savings or your identity or have your visa cancelled.

link for the misleading information:

http://www.immi.gov.au/migration-fraud/migration-fraud-be-informed.htm

Quotes:
"Wise men learn from their mistakes, but wiser men learn from the mistakes of others."
'Success is when you finished what you have started."

If you’re looking for Church in Canberra ACT Australia and you want to fellowship with Christian Filipino Australian.
Come and join us in Jesus Is Lord Church Canberra service every Sunday at 10:30AM to 12:30PM
Where: 53 Georgina Crescent, Kaleen ACT 2617
(Back of Kaleen Shopping Centre)
For more information, please PM me or visit

http://jilcanberra.org.au

"To God be the glory"

«13

Comments

  • heyits7me_magsheyits7me_mags Imus City
    Posts: 599Member
    Joined: Jan 13, 2011
    Here's info. on how to find migration agent...

    05/17/11 - ACS favorable result released for my husband's skills assessment nominated job-261311 Analyst Programmer.
    12/10/11 - Hubby IELTS first take at BC result L & R-5.5, W & S-6.0 OBS=6.0 retake!!!
    12/30/11- Hubby registered at 9.0 Niners.
    03/15/14 - Hubby's comeback at 9.0 Niners preparing for IELTS test. Second attempt for Australian visa.
    05/12/14 - Complete uploading of ACS skills assessment required documents and payment made thru direct deposit.
    05/12/14 - ACS assessment application received.
    07/02/14 - ACS skills assessment result suitable ANZCO code 262113 Systems Administrator as recommended by CO for hubby's job description rather than ANZCO 261311 Analyst Programmer the first ACS ANZCO result suitable released in 2011. I conclude ACS reclassifies ICT Occupations.
    - Work exp. 12yrs. less 6yrs deduction by ACS.
    - Educ. Qualification assessed as AQF Associate Degree major in computing for a 4yr. course BS. Computer Science in a section 2 school.

  • LokiJrLokiJr Quezon City
    Posts: 2,616Member, Moderator
    Joined: Jan 13, 2011
    Learned this from a friend.
    Consult with a trusted migration agent but don't their advice as the absolute truth. Do your homework and research...seek advice from other agents...that way, you are sure that the advice you are getting is the best possible approach to your situation :)
  • heyits7me_magsheyits7me_mags Imus City
    Posts: 599Member
    Joined: Jan 13, 2011
    @Lokijr, i agree with u!!!...what i have posted above is just an idea. :)

    05/17/11 - ACS favorable result released for my husband's skills assessment nominated job-261311 Analyst Programmer.
    12/10/11 - Hubby IELTS first take at BC result L & R-5.5, W & S-6.0 OBS=6.0 retake!!!
    12/30/11- Hubby registered at 9.0 Niners.
    03/15/14 - Hubby's comeback at 9.0 Niners preparing for IELTS test. Second attempt for Australian visa.
    05/12/14 - Complete uploading of ACS skills assessment required documents and payment made thru direct deposit.
    05/12/14 - ACS assessment application received.
    07/02/14 - ACS skills assessment result suitable ANZCO code 262113 Systems Administrator as recommended by CO for hubby's job description rather than ANZCO 261311 Analyst Programmer the first ACS ANZCO result suitable released in 2011. I conclude ACS reclassifies ICT Occupations.
    - Work exp. 12yrs. less 6yrs deduction by ACS.
    - Educ. Qualification assessed as AQF Associate Degree major in computing for a 4yr. course BS. Computer Science in a section 2 school.

  • heyits7me_magsheyits7me_mags Imus City
    Posts: 599Member
    Joined: Jan 13, 2011
    edited November 2011
    @Lokijr, Have u heard about ausfis? its a scam, i have a friend who pay an equivalent PhP60,000 thru his credit card by phone using the internet accout of this organization but until now this org. did not get back to him for any info. about status of his visa processing. What they had ask to my friend is just a CV only. He realized that he was victimized when he reads on the other int'l. forum about other people who had the same experience with him.

    :(

    05/17/11 - ACS favorable result released for my husband's skills assessment nominated job-261311 Analyst Programmer.
    12/10/11 - Hubby IELTS first take at BC result L & R-5.5, W & S-6.0 OBS=6.0 retake!!!
    12/30/11- Hubby registered at 9.0 Niners.
    03/15/14 - Hubby's comeback at 9.0 Niners preparing for IELTS test. Second attempt for Australian visa.
    05/12/14 - Complete uploading of ACS skills assessment required documents and payment made thru direct deposit.
    05/12/14 - ACS assessment application received.
    07/02/14 - ACS skills assessment result suitable ANZCO code 262113 Systems Administrator as recommended by CO for hubby's job description rather than ANZCO 261311 Analyst Programmer the first ACS ANZCO result suitable released in 2011. I conclude ACS reclassifies ICT Occupations.
    - Work exp. 12yrs. less 6yrs deduction by ACS.
    - Educ. Qualification assessed as AQF Associate Degree major in computing for a 4yr. course BS. Computer Science in a section 2 school.

  • mimaahkmimaahk Singapore
    Posts: 157Member
    Joined: Jun 27, 2011
    @heyits7me_mags sad naman nyan, sayang ang 60K grabe!

    ...yung isang nabasa ko naman sa forum after yrs of waiting for 175 visa, negative result from DIAC due to lack of requirements... non MARA agent daw, sayang ang binayad tsk tsk. Kailangan talagang maging maingat at manigurado sa pagpili ng agent.
  • heyits7me_magsheyits7me_mags Imus City
    Posts: 599Member
    Joined: Jan 13, 2011
    @mimaahk, sayang nga eh yung Php60k nya, ang siste tinawagan sya then this org. convinced him that there will be a bigger chance for my friend to get to Australia, hindi nga lang in details ang pakakwento sa amin nun husband ko. This friend of ours really believed na maaayos ang visa nya ang initial docs. hiningi ay cv lang tapos binigyan sya ng link sa internet to log in personal details at payment na halagang Php60k nagpa debit naman ang friend namin at binigay din yung card details. Ayun pag check nya sa SOA ng card nya na debit nga raw sya. antay sya tumawag yung ausfis hanggang ngayon almost a year na 'la pa update, nagtanong tanong sa sya amin dati pa kasi nababasa ko na yan sa British expats.com na marami nga raw na victimized pati sila tanung tanong na rin, later they found out na scam lang pala sila ng big sum of cash. SAYANG!!...nauna na kasing na biktima yung friend ko bago namin nalaman na nangyari na sa kanya...HULI na ang lahat!!!. Yang ausfis na yan meron namang website pero parang hindi naman active nun tsinek ko. :(

    05/17/11 - ACS favorable result released for my husband's skills assessment nominated job-261311 Analyst Programmer.
    12/10/11 - Hubby IELTS first take at BC result L & R-5.5, W & S-6.0 OBS=6.0 retake!!!
    12/30/11- Hubby registered at 9.0 Niners.
    03/15/14 - Hubby's comeback at 9.0 Niners preparing for IELTS test. Second attempt for Australian visa.
    05/12/14 - Complete uploading of ACS skills assessment required documents and payment made thru direct deposit.
    05/12/14 - ACS assessment application received.
    07/02/14 - ACS skills assessment result suitable ANZCO code 262113 Systems Administrator as recommended by CO for hubby's job description rather than ANZCO 261311 Analyst Programmer the first ACS ANZCO result suitable released in 2011. I conclude ACS reclassifies ICT Occupations.
    - Work exp. 12yrs. less 6yrs deduction by ACS.
    - Educ. Qualification assessed as AQF Associate Degree major in computing for a 4yr. course BS. Computer Science in a section 2 school.

  • heyits7me_magsheyits7me_mags Imus City
    Posts: 599Member
    Joined: Jan 13, 2011
    Got this page from British expats.com about ausfis.org

    /britishexpats.com/forum/showthread.php?t=660020

    05/17/11 - ACS favorable result released for my husband's skills assessment nominated job-261311 Analyst Programmer.
    12/10/11 - Hubby IELTS first take at BC result L & R-5.5, W & S-6.0 OBS=6.0 retake!!!
    12/30/11- Hubby registered at 9.0 Niners.
    03/15/14 - Hubby's comeback at 9.0 Niners preparing for IELTS test. Second attempt for Australian visa.
    05/12/14 - Complete uploading of ACS skills assessment required documents and payment made thru direct deposit.
    05/12/14 - ACS assessment application received.
    07/02/14 - ACS skills assessment result suitable ANZCO code 262113 Systems Administrator as recommended by CO for hubby's job description rather than ANZCO 261311 Analyst Programmer the first ACS ANZCO result suitable released in 2011. I conclude ACS reclassifies ICT Occupations.
    - Work exp. 12yrs. less 6yrs deduction by ACS.
    - Educ. Qualification assessed as AQF Associate Degree major in computing for a 4yr. course BS. Computer Science in a section 2 school.

  • aldousnowaldousnow Sydney
    Posts: 494Member
    Joined: Nov 16, 2011
    Be careful mates. Kung kaya naman walang agent.. wag na mag agent. Bawas gastos. Madami naman naaaprove ng walang agent.. and madami na din pwede mapag tanungin dito. Yun lang. God bless us all.

    Skilled – Family Sponsored (Migrant) Visa (Subclass 176)
    Nominated Occupation : Developer Programmer (261312)
    02/28/2011 - ACS Finalized the Case (261312, PIM3, Group A)
    03/07/2011 - IELTS Result Received L- 6.5, R-7.0, W-6.0, S-7.0, Overall Band Score-6.5 (BC)
    03/13/2011 - Lodged Visa Application (Online)
    11/09/2011 - CO Allocation
    12/02/2011 - Medicals Finalised
    12/02/2011 - FINISH LINE!! (Visa Grant)
    03/23/2012 - My first day @Melbourne
    04/14/2012 - Started looking for a .Net Developer job
    06/04/2012 - And finally got one! :)

  • BryannBryann Sydney
    Posts: 854Member
    Joined: May 27, 2011
    Yeah unless sobrang complicated ng case niyo, magbasa na lang and pag-aralan ang pag-apply madali lang naman eh. And if ever kukuha kayo services ng agent, check the MARA site first to make sure registered sya.

    Occupation: ICT Software Engineer (ANZSCO 261313)
    Dec 13 2011 - ACS: Suitable (AQF Diploma)
    Feb 03 2012 - IELTS #1 Failed (W-6.5)
    Mar 02 2012 - IELTS #2 Passed
    Apr 21 2012 - 175 Visa Lodged Online
    May 29 2012 - CO Assigned
    Jun 25 2012 - Visa Grant (IED: Dec 14 2012)
    Aug 19 2012 - Arrived in Sydney
    Sept 10 2012 - Start @ 1st Job (Web Developer)

  • heyits7me_magsheyits7me_mags Imus City
    Posts: 599Member
    Joined: Jan 13, 2011
    edited November 2011
    BEWARE OF FAKE SCAMMERS : Update from immi facebook page...

    Australian Department of Immigration and Citizenship
    BEWARE OF SCAMMERS -- Fake offers of NSW sponsorship for skilled migration are being made by and also from /

    NSW Trade & Investment advises these are NOT legitimate offers of NSW Government sponsorship for skilled migration. Please do NOT provide passport details or make any payments in response to this scam. For any inquiries please contact NSW Trade & Investment at: .

    Ingat, ingat kayo wag agad maniwala sa mga offer at word of mouth fr. the internet. :-)

    05/17/11 - ACS favorable result released for my husband's skills assessment nominated job-261311 Analyst Programmer.
    12/10/11 - Hubby IELTS first take at BC result L & R-5.5, W & S-6.0 OBS=6.0 retake!!!
    12/30/11- Hubby registered at 9.0 Niners.
    03/15/14 - Hubby's comeback at 9.0 Niners preparing for IELTS test. Second attempt for Australian visa.
    05/12/14 - Complete uploading of ACS skills assessment required documents and payment made thru direct deposit.
    05/12/14 - ACS assessment application received.
    07/02/14 - ACS skills assessment result suitable ANZCO code 262113 Systems Administrator as recommended by CO for hubby's job description rather than ANZCO 261311 Analyst Programmer the first ACS ANZCO result suitable released in 2011. I conclude ACS reclassifies ICT Occupations.
    - Work exp. 12yrs. less 6yrs deduction by ACS.
    - Educ. Qualification assessed as AQF Associate Degree major in computing for a 4yr. course BS. Computer Science in a section 2 school.

  • heyits7me_magsheyits7me_mags Imus City
    Posts: 599Member
    Joined: Jan 13, 2011
    edited November 2011
    ..being made by and also from /

    at:.

    ...yan po yung ikinopy ko na wala sa taas ang net address.

    ...haay! wala po talaga kahit i-type kopa protected yata yung address. Paki refer na lang po sa fb page.

    05/17/11 - ACS favorable result released for my husband's skills assessment nominated job-261311 Analyst Programmer.
    12/10/11 - Hubby IELTS first take at BC result L & R-5.5, W & S-6.0 OBS=6.0 retake!!!
    12/30/11- Hubby registered at 9.0 Niners.
    03/15/14 - Hubby's comeback at 9.0 Niners preparing for IELTS test. Second attempt for Australian visa.
    05/12/14 - Complete uploading of ACS skills assessment required documents and payment made thru direct deposit.
    05/12/14 - ACS assessment application received.
    07/02/14 - ACS skills assessment result suitable ANZCO code 262113 Systems Administrator as recommended by CO for hubby's job description rather than ANZCO 261311 Analyst Programmer the first ACS ANZCO result suitable released in 2011. I conclude ACS reclassifies ICT Occupations.
    - Work exp. 12yrs. less 6yrs deduction by ACS.
    - Educ. Qualification assessed as AQF Associate Degree major in computing for a 4yr. course BS. Computer Science in a section 2 school.

  • heyits7me_magsheyits7me_mags Imus City
    Posts: 599Member
    Joined: Jan 13, 2011
    I got this from immi facebook page about warning sign about migration fraud.

    migration-fraud/migration-fraud-be-informed.htm.

    05/17/11 - ACS favorable result released for my husband's skills assessment nominated job-261311 Analyst Programmer.
    12/10/11 - Hubby IELTS first take at BC result L & R-5.5, W & S-6.0 OBS=6.0 retake!!!
    12/30/11- Hubby registered at 9.0 Niners.
    03/15/14 - Hubby's comeback at 9.0 Niners preparing for IELTS test. Second attempt for Australian visa.
    05/12/14 - Complete uploading of ACS skills assessment required documents and payment made thru direct deposit.
    05/12/14 - ACS assessment application received.
    07/02/14 - ACS skills assessment result suitable ANZCO code 262113 Systems Administrator as recommended by CO for hubby's job description rather than ANZCO 261311 Analyst Programmer the first ACS ANZCO result suitable released in 2011. I conclude ACS reclassifies ICT Occupations.
    - Work exp. 12yrs. less 6yrs deduction by ACS.
    - Educ. Qualification assessed as AQF Associate Degree major in computing for a 4yr. course BS. Computer Science in a section 2 school.

  • BryannBryann Sydney
    Posts: 854Member
    Joined: May 27, 2011
    Dami talaga manloloko. Muntik na ako dati mag-avail ng services ng isang agent dito sa Pinas (Makati). Nasa MARA naman sila, registered sila dun yun agent. Although meron sila office dito, yun agent is OZ based. Medyo nagf-followup pa sakin yun lagi eh un secretary dun. Biruin nyo in less than 1 year, I checked back their office, vacated na. Wala na yun office dun. Haha. Kung sakali saan ko sila hahabulin.

    Kaya then on I decided na sariling sikap na lang. Magtiyaga na lang ako magbasa at magtanong sa mga may experience na.

    Occupation: ICT Software Engineer (ANZSCO 261313)
    Dec 13 2011 - ACS: Suitable (AQF Diploma)
    Feb 03 2012 - IELTS #1 Failed (W-6.5)
    Mar 02 2012 - IELTS #2 Passed
    Apr 21 2012 - 175 Visa Lodged Online
    May 29 2012 - CO Assigned
    Jun 25 2012 - Visa Grant (IED: Dec 14 2012)
    Aug 19 2012 - Arrived in Sydney
    Sept 10 2012 - Start @ 1st Job (Web Developer)

  • heyits7me_magsheyits7me_mags Imus City
    Posts: 599Member
    Joined: Jan 13, 2011
    Buti hindi ka tumuloy at @Bryann, yung sa kumpare namin nadenggoy ng AUSFIS yung kumakalat dati sa internet tapos tatawagan ka hihingi agad ng bayad upfront sa pmamagitan ng credit card, Php60k ang nadale sa kanya...wala ngayon hindi na nya mahagilap.

    05/17/11 - ACS favorable result released for my husband's skills assessment nominated job-261311 Analyst Programmer.
    12/10/11 - Hubby IELTS first take at BC result L & R-5.5, W & S-6.0 OBS=6.0 retake!!!
    12/30/11- Hubby registered at 9.0 Niners.
    03/15/14 - Hubby's comeback at 9.0 Niners preparing for IELTS test. Second attempt for Australian visa.
    05/12/14 - Complete uploading of ACS skills assessment required documents and payment made thru direct deposit.
    05/12/14 - ACS assessment application received.
    07/02/14 - ACS skills assessment result suitable ANZCO code 262113 Systems Administrator as recommended by CO for hubby's job description rather than ANZCO 261311 Analyst Programmer the first ACS ANZCO result suitable released in 2011. I conclude ACS reclassifies ICT Occupations.
    - Work exp. 12yrs. less 6yrs deduction by ACS.
    - Educ. Qualification assessed as AQF Associate Degree major in computing for a 4yr. course BS. Computer Science in a section 2 school.

  • JClemJClem Melbourne
    Posts: 528Member
    Joined: Jan 08, 2011
    edited February 2012
    Ang advice ko na lang sa mga aspiring applicants if straightforward naman ang case mo and marami naman kayong time on your own na asikasuhin ang requirements, don't bother to hire an agent. Dagdag lang sa gastos. Yung iba kung sumingil mas mahal pa sa visa application fee. And the way I see it kayo pa din naman talaga mag-aasikaso lahat. Hindi naman sila ang pupunta sa schools or susulat ng competency demonstration report mo (for engineers), ikaw pa din gagawa nun. Ikaw pa din ang magta-take ng IELTS, hindi sila. Be resourceful lang, kaya yan. Sipag, tiyaga and dasal pagsama-samahin and you will never go astray. :)

    Nominated Occupation: Software Engineer (261313) - Husband is the primary applicant.

    10.21.2012 - Arrived in Melbourne. This is the day that the Lord has made. :)
    03.26.2012 - Visa granted. God is good, all the time! All the time, God is good! :)
    03.23.2012 - PCC submitted and medicals finalized
    03.02.2012 - Application being processed further / CO assigned
    06.26.2011 - Lodged Visa 175 application

  • heyits7me_magsheyits7me_mags Imus City
    Posts: 599Member
    Joined: Jan 13, 2011
    Panay panay ang paalala ng DIAC s mga aspiring immigrant about migration fraud lalu na sa facebook nila.

    05/17/11 - ACS favorable result released for my husband's skills assessment nominated job-261311 Analyst Programmer.
    12/10/11 - Hubby IELTS first take at BC result L & R-5.5, W & S-6.0 OBS=6.0 retake!!!
    12/30/11- Hubby registered at 9.0 Niners.
    03/15/14 - Hubby's comeback at 9.0 Niners preparing for IELTS test. Second attempt for Australian visa.
    05/12/14 - Complete uploading of ACS skills assessment required documents and payment made thru direct deposit.
    05/12/14 - ACS assessment application received.
    07/02/14 - ACS skills assessment result suitable ANZCO code 262113 Systems Administrator as recommended by CO for hubby's job description rather than ANZCO 261311 Analyst Programmer the first ACS ANZCO result suitable released in 2011. I conclude ACS reclassifies ICT Occupations.
    - Work exp. 12yrs. less 6yrs deduction by ACS.
    - Educ. Qualification assessed as AQF Associate Degree major in computing for a 4yr. course BS. Computer Science in a section 2 school.

  • mokona14mokona14 Mandaluyong
    Posts: 89Member
    Joined: Feb 19, 2012
    di po ba pag registered sa MARA okey po un,.dapat siguro maging maingat nalang po sa pagkuha ng agent o kaya sariling diskarte nalang,.search, search tas tanung tanong,.god bless po sating lahat :)
  • BryannBryann Sydney
    Posts: 854Member
    Joined: May 27, 2011
    @mokona14
    Not necessarily. Dapat din check mo maigi yun background if how long na sila registered. Meron kasi iba dun, 1 registration period lang tapos nawawala na. Meron nga dun pinay na MARA registered, sa RCBC yun office niya, naka-lagay sa MARA site suspended kasi nawala na lang dun sa office. Nag-AWOL in short. Tapos iniwan na lang sa ere yun mga clients niya. Syempre tangay na din yun pera. So have to be really vigilant in choosing an agent. Search the forums for any feedback. Not only here, pero sa iba pang active forums.

    Occupation: ICT Software Engineer (ANZSCO 261313)
    Dec 13 2011 - ACS: Suitable (AQF Diploma)
    Feb 03 2012 - IELTS #1 Failed (W-6.5)
    Mar 02 2012 - IELTS #2 Passed
    Apr 21 2012 - 175 Visa Lodged Online
    May 29 2012 - CO Assigned
    Jun 25 2012 - Visa Grant (IED: Dec 14 2012)
    Aug 19 2012 - Arrived in Sydney
    Sept 10 2012 - Start @ 1st Job (Web Developer)

  • thegoldenabzthegoldenabz Quezon City
    Posts: 4Member
    Joined: Mar 07, 2012
    Hi, I want to live and work in Australia so I did my research online at ngtry ako ng free assessment sa link na ito www.globalvisas.com. Then after couple of days, may tumawag sa akin taga globalvisas daw cya based in Cebu (John Paul Pacheco) Ayon sabi nya kailangan ko raw ay work permit daw. Magbabayad daw ako ng 100k for the processing tapos yun lang daw ang babayaran ko which is I doubt. Tapos tumawag na naman sila sa akin kasi inaassess nila ang job qualification ko , gusto ko kasi yung ICT Customer Support. then sabi ko na ireresearch ko muna kung pasok ba experiences ko as ICT Customer Support. Then ngemail na sila sa akin.

    8 March 2012
    Ref: 2081692


    Dear Miss Abne,

    Re: Global Visa: International Employment Solutions

    Firstly, I would like to take this opportunity to thank you for choosing Global Visas.

    Further to our recent conversation and from the information you provided to me, I can confirm that you are eligible for our International Employment Solutions, through this route we can provide you with our certificate of eligibility, and country specific employment and work visa information and requirements. We also offer specialist support and assistance to target and achieve your ideal job.

    Immigration law and securing employment overseas has become increasingly difficult, it constitutes one of the fastest growing trends amongst highly qualified and skilled professionals. The laws governing overseas workers are also some of the fastest changing laws, as the World’s most sought after employment destinations are fielding more applications from the World’s workforce seeking to benefit from the opportunities available in those countries. As a result, case officers are often under pressure to achieve results, refusing cases or conducting in-depth investigations.

    Global Visas are proud to have an excellent working relationship with these Officers; our company and our clients’ cases are always treated with respect and are dealt with in a timely and professional manner.

    Global mobility has accelerated rapidly over the last 20 years and this trend is set to continue. Consequently, Governments are in the unenviable position of relying on legislation which is not able to keep up with the international skills market and internet-driven globalization. At Global Visas we understand the pressure faced by Immigration systems, we understand their goals and we know how best to assist our clients. Our success rate is second to none.

    We currently have ten offices world wide with plans to open several more in the coming years. We currently serve over 150 different nationalities as our network of offices span the Globe and with modern working practices we serve people daily wherever they are in the world.

    The most important fact about Global Visas is that it’s likely we have an office in the country of your future employment and home. This makes us accessible to you to provide the support you require over the first few years in your new country. It also often means we have already worked with your new employer previously to secure visas for other overseas skilled workers.

    As you might expect from the world’s leading experts in visas. We assist the world’s leading businesses, international organisations, celebrities and over 20,000 individuals to successfully secure their visas each year.

    What Our Service Provides:

    • We will advise on current work permit rules for your destination of choice and how that relates to the minimum job requirements
    • We will offer alternatives where your skills and experience do not meet the requirements of that country.
    • We will reformat your CV to an International standard and make amendments where necessary.
    • We will issue you with a certificate of eligibility for a working visa.
    • We will provide you with links to enable you to search for employment and also to allow you to register with a governing body should your chosen profession require it.
    • We will actively source employment for you through our network of international recruitment agencies or directly with our growing list of major employers in each country.
    • We are here to offer assistance, guidance and to actively search for employment in parallel with your own efforts.

    What makes us Unique?

    Size does matter when it comes to Immigration. We have an office in the country you want to make your home. That is VITAL to provide the support and assistance you will require in the first few years after arrival as you extend your visa. Due to our size you can be assured we will be with you every step of the way.

    We are the World’s No.1. Our client’s are assured we are the finest in our field, our exciting mix of staff from Solicitors to Immigration experts are all highly trained professionals who are always on hand to assist you with any questions you may have. We support thousands of companies all over the world solving international mobility issues for their staff with ease.

    -----------------

    Please naman sna may makatulong kung geniune sila. Kasi ngresearch din ako sa mga forum at ang raming negative comments sa kanila. Tinanong ko nga sila regarding this negative comments sabi nila normal lang daw yun sa isang company. Ngayon ang gusto ko sana malaman kung meron na ba talagang naassist sila na Pinoy na nakapunta at nakapagtrabaho sa Australia para makasigurado.

    Sabi din nila registered sila sa MARA at sa SEC. Ngayon I'm asking them kung pwde maibigay nila sa akin yung Migration agent nila na registered sa MARA at yung SEC registration number. Wait palang ako sa reply nila.

    So check ko ulit website nila at napagalaman ko na meron silang MARA registration number (im not sure kung sa kanila ito) then I checked it with MARA. Ito yung details:

    TAE-SOO MIN
    Migration Agent Registration Number: 1068924
    Business NameGlobal Visas Australia
    Phone(02) 9280 4448
    Facsimile(02) 9280 4447
    Email Address: tm2402@hotmail.com
    Business Address Suite 202
    695-699 George Street
    SYDNEY NSW 2000
    AUSTRALIA
    List other agents in this area
    Relation to Business Employee
    Postal Address 40 / 121 - 133 Pacific Hwy
    HORNSBY NSW 2077
    AUSTRALIA
    Status: Registered.


    Then enimail ko yung Migration Agent (TAE-SOO MIN) and waiting for his/her reply. Yun nga lng bakit yung email address e naka hotmail lng diba dapat mas professional kung company domain ang ginamit nila??? Nakapagtataka at nakakapagdalawang isip.


    Please sana po matulungan ninyo ako.

    Maraming salamat po.
    Abby
  • BryannBryann Sydney
    Posts: 854Member
    Joined: May 27, 2011
    edited March 2012
    @thegoldenabz
    From what I know, kasi dati naging option ko din kumuha ng migration agent, dapat lahat ng offices nun agent is nakalagay dun sa MARA website kapag sinearch mo yun pangalan nila. Hindi pwede yun reference lang nila. So that includes Philippine offices. Dapat yun sinasabi nilang office sa Cebu ay nakaregister din with MARA.

    Take this guy for example, yun office niya sa Makati nakialagay din dun sa MARA site.

    https://www.mara.gov.au/agent/ARDetails.aspx?ud=3759&FolderID=394

    Magaling magsalita sa email yan, pero kaduda-duda yun credibility. I'm not passing judgement but some people will do or say just about anything to get your money. Kaka-register lang din pala nya last January 2012.

    I'm not promoting Respall's services but siya yun madalas ko makita sa mga forums. Alam ko meron pa isa, Pines ba yun? Maybe other members here have their recommendations as well.

    Occupation: ICT Software Engineer (ANZSCO 261313)
    Dec 13 2011 - ACS: Suitable (AQF Diploma)
    Feb 03 2012 - IELTS #1 Failed (W-6.5)
    Mar 02 2012 - IELTS #2 Passed
    Apr 21 2012 - 175 Visa Lodged Online
    May 29 2012 - CO Assigned
    Jun 25 2012 - Visa Grant (IED: Dec 14 2012)
    Aug 19 2012 - Arrived in Sydney
    Sept 10 2012 - Start @ 1st Job (Web Developer)

  • thegoldenabzthegoldenabz Quezon City
    Posts: 4Member
    Joined: Mar 07, 2012
    @bryan..

    Sir thank talaga sa information. It really help a lot.
    Newbie kasi ako pagdating sa mga ganito. Pero gusto ko po talagang magwork sa Australia kasi pangarap ko po iyan. I will try to contact Respall's office for inquiries.

    Another thing po pala, talaga po bang in demand sa Australia ngayon ang mga IT related jobs? Kasi yun din po ang sinabi sa akin ng immigration consultancy eh. Naninigurado lng po.

    Thank you and more power

    by the way ngreply na si migration agent, ito yung cinabi nya:

    Dear Abby

    Thank you for the enquiry This email is to introduce myself as a registered migration agent in Australia and I have received your enquiry through my personal email account. Please find my answers as follow in response to your queries accordingly.
    ___________________

    I recently went to Global Visas website to go through the free assessment and someone from Global Visas based in the Philippines whose name is John Paul Pacheco from Cebu City called me and told me how the process works. He said that I will need a work permit in Australia and need to pay Php100,000 (more or less 3000AUD) for the processing fee and that global visas will assist me in finding an employer in Australia. He also said that global visas will make sure that I have the job order first before departing to Australia and that I will not pay for anything aside from the processing fee. - 1.Yes, you need to job offer for a temporary work visa in Australia. 2.I have no idea how much you will get charged in Philippines. 3. Global Visas have a service called IES (International Employment Service) but we do not look for a job for you. We will put your qualification, experience etc together and get your CV nicer and better but there is no guarantee ("make sure") you will get a job offer. 4. There is application fee for the Asutralian Dept. which depends on the visa types.
    It seems to good to be true. I do not think that I will only pay P100,000 (P100,000 is quite big to be honest with you but if this is really legit then I would like to try). - There is application fee for the Asutralian Dept. which depends on the visa types.
    I would like to know if you as the migration agent had experienced assisting migrants/workers from the Philippines and if these people where successful enough in landing Australian jobs. Having known that Global Visas Australia is currently registered in MARA is a breather to me however I want to make sure that your counterpart(s) here in the Philippines also has the same credibility as yours. It's been my dream to live and work in Australia so I'm sourcing any possible means just to grab it. - 1. Yes, certainly, there are many Filipinos successfully completed therir visa application process and currently in Australia (many of my clients) but it is also true not everyone from Philippines are successful. 2. I have no idea if there is anybody in Cebu office are MARA licensed (you need to check) and IMPORTANLY, please note, unless the case (application) comes in to my desk and (physically) reviewed by myself, that case has got nothing to do with me.

    Hope I have answered your enquiry.

    Thank you.

    Best wishes



    Tony Min
    Client Services Manager

    Tel: +61 (02) 9280 4448
    Email: tony.mi@globalvisas.com
    Web: www.globalvisas.com


  • BryannBryann Sydney
    Posts: 854Member
    Joined: May 27, 2011
    @thegoldenabz
    There you go. Yun nag-email sa iyo is legit, and andun un email nya in globalvisas.com sa signature niya. So ang issue na lang is yun sa Cebu, I think they are just using his identity from what I understand in his response.

    Occupation: ICT Software Engineer (ANZSCO 261313)
    Dec 13 2011 - ACS: Suitable (AQF Diploma)
    Feb 03 2012 - IELTS #1 Failed (W-6.5)
    Mar 02 2012 - IELTS #2 Passed
    Apr 21 2012 - 175 Visa Lodged Online
    May 29 2012 - CO Assigned
    Jun 25 2012 - Visa Grant (IED: Dec 14 2012)
    Aug 19 2012 - Arrived in Sydney
    Sept 10 2012 - Start @ 1st Job (Web Developer)

  • k_mavsk_mavs Melbourne
    Posts: 712Member
    Joined: May 30, 2011
    Parang ang dami na talagang scammers ngayon. If me budget ka naman at wala kang time para mag ayos ng papers personally might as well inquire for the services of respall. Medyo mahal lang nga pero at least may mga successful applicants na silang napapunta ng Oz. Good luck sayo!

    “We can make our own plans, but the LORD gives the right answer.”

  • thegoldenabzthegoldenabz Quezon City
    Posts: 4Member
    Joined: Mar 07, 2012
    Ngtanong din ako sa iba pang mga forums at yung nga scam nga daw itong agency sa Cebu. Hay... buti na lng at kung hindi goodbye 100k...

    I called Respall din at hinihintay ko pa feedback nila kasi they requested me to send my resume for their evaluation. Sa tingin nyo kaya mga magkano ang magagastos for their services?

  • k_mavsk_mavs Melbourne
    Posts: 712Member
    Joined: May 30, 2011
    Yung qoute po nila akin dati is 3000 Aud. Professional fee pa lang po yun plus yung visa fee (2960 Aud) plus skills assessment fee. This is way back 2009. Kaya po di ko na rin na pursue yung services nila kasi sobrang mahal. Pero kung may budget ka nga at can afford mo the go ka na lang sa kanila. :D

    “We can make our own plans, but the LORD gives the right answer.”

  • mokona14mokona14 Mandaluyong
    Posts: 89Member
    Joined: Feb 19, 2012
    waaahhh scamer po ba global visa???sila pa nmn nakuha kong agent:( wag nmn po sana :(
  • k_mavsk_mavs Melbourne
    Posts: 712Member
    Joined: May 30, 2011
    @mokona14 Ngek! problema po ata yan. pero ang sabi nila naman yung office na nasa cebu ata yung parang me problema. Check mo na lang po ulit.

    “We can make our own plans, but the LORD gives the right answer.”

  • mokona14mokona14 Mandaluyong
    Posts: 89Member
    Joined: Feb 19, 2012
    edited March 2012
    :( huhuhuhu pero sana nmn po hindi,.hindi ko pa po kasi complete ung mga docs ko,.pero everyday po sila nagfofolow up sakin,.ask po nila ako lage kung may nauplod n ko n docs,.tas lage din sila call sa jowa ko sa aus,.tas nung nag partial payment nmn po kme is my receipt nmn po sila na binigay,. :(
  • darmah6841darmah6841 Balanga
    Posts: 1Member
    Joined: Mar 19, 2012
    @thegoldenabz same case here po, recently offered by the same person and company. Sobrang thankful po ako I found this forum kasi nasagot ang queries ko whether to pursue my application with them or not. Relieved na ako. :)
  • mokona14mokona14 Mandaluyong
    Posts: 89Member
    Joined: Feb 19, 2012
    still praying po na hindi,.malapit na kasi me makakumpleto ng mga docs,.goodluck nlang kung scam nga yun or not,.no choice na ko eh,.basta pray pa din:)
Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

mhickarnKlausMetzgDanielle60DarellBostemmnlldllbumblebimsadikmacjen.gatchHOPING2018mastersifuzindylittlemissarchiGenaGerstaReubenRandbluerainpatcwdesignermaryannkentrodriguezAdelainetormisMarilyn
Browse Members

Members Online (0) + Guest (94)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌