Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

Student Visa (Step by step)

1102103105107108591

Comments

  • maliboomaliboo Davao City
    Posts: 233Member
    Joined: Jun 11, 2013
    @acelechi15 gnyan dn ngyre sken nung ngdefer ako you have to call the school to follow up sa email mo. And mareresolve nla un and plus mssgot n rin ung qstns mo 15 pr minute ata ang rate. Musta nman ang jetstar?pano ung check in baggage?

    Subclass 573 (SVP) commencement date Aug 12
    May 21 - lodged visa application
    May 23 - DIAC acknowledged application
    May 31 - Medicals NHSI
    June 4 - NHSI submitted results
    June 10 - Medicals referred to MOC June 4
    June 25 - was informed we needed addtl tests for hubby
    June 28 - hubby's meds uploaded and referred to HOC AUSTRALIA
    June 23 - received email from DIAC stating "we have recently received your husbands medical clearance".
    Aug 1 - request form 815 health undertaking passed it on the same day :)
    Aug 5 - emailed diac that i have to be able to attend uni on the 12th otherwise i would need to defer my course.
    Aug 6 - they might have read my email and issued a grant at 2pm
    Aug 7 - received sms that they have dispatched documents thru courier

    Thank you god!!:) im done waiting :)

  • maliboomaliboo Davao City
    Posts: 233Member
    Joined: Jun 11, 2013
    @tenseako hndi pa nga eh curious ako sa studeny discout nla and 40kg baggage..kaw ba?may alam ka ba about it?hehe

    Subclass 573 (SVP) commencement date Aug 12
    May 21 - lodged visa application
    May 23 - DIAC acknowledged application
    May 31 - Medicals NHSI
    June 4 - NHSI submitted results
    June 10 - Medicals referred to MOC June 4
    June 25 - was informed we needed addtl tests for hubby
    June 28 - hubby's meds uploaded and referred to HOC AUSTRALIA
    June 23 - received email from DIAC stating "we have recently received your husbands medical clearance".
    Aug 1 - request form 815 health undertaking passed it on the same day :)
    Aug 5 - emailed diac that i have to be able to attend uni on the 12th otherwise i would need to defer my course.
    Aug 6 - they might have read my email and issued a grant at 2pm
    Aug 7 - received sms that they have dispatched documents thru courier

    Thank you god!!:) im done waiting :)

  • acelechi15acelechi15 Woolloongabba
    Posts: 134Member
    Joined: Jul 29, 2013
    @maliboo thank you for the advice!!! Kakatawag ko lang and sabi nag-email na raw sila sa IDP and urgently needed ang signature ko. IDP naman didn't inform me. :( nakakastress tuloy.
  • maliboomaliboo Davao City
    Posts: 233Member
    Joined: Jun 11, 2013
    @acelechi15 now call IDP pra mgkaron cla ng sense of urgency bka naoverlook :) open cla til 3pm mabait nmn c ms joan sa reception eh :)

    Subclass 573 (SVP) commencement date Aug 12
    May 21 - lodged visa application
    May 23 - DIAC acknowledged application
    May 31 - Medicals NHSI
    June 4 - NHSI submitted results
    June 10 - Medicals referred to MOC June 4
    June 25 - was informed we needed addtl tests for hubby
    June 28 - hubby's meds uploaded and referred to HOC AUSTRALIA
    June 23 - received email from DIAC stating "we have recently received your husbands medical clearance".
    Aug 1 - request form 815 health undertaking passed it on the same day :)
    Aug 5 - emailed diac that i have to be able to attend uni on the 12th otherwise i would need to defer my course.
    Aug 6 - they might have read my email and issued a grant at 2pm
    Aug 7 - received sms that they have dispatched documents thru courier

    Thank you god!!:) im done waiting :)

  • maliboomaliboo Davao City
    Posts: 233Member
    Joined: Jun 11, 2013
    @acelechi ano school mo?nung ngparevise ako ng coe wla nmn signature na involved.malayo ka ba sa idp?

    Subclass 573 (SVP) commencement date Aug 12
    May 21 - lodged visa application
    May 23 - DIAC acknowledged application
    May 31 - Medicals NHSI
    June 4 - NHSI submitted results
    June 10 - Medicals referred to MOC June 4
    June 25 - was informed we needed addtl tests for hubby
    June 28 - hubby's meds uploaded and referred to HOC AUSTRALIA
    June 23 - received email from DIAC stating "we have recently received your husbands medical clearance".
    Aug 1 - request form 815 health undertaking passed it on the same day :)
    Aug 5 - emailed diac that i have to be able to attend uni on the 12th otherwise i would need to defer my course.
    Aug 6 - they might have read my email and issued a grant at 2pm
    Aug 7 - received sms that they have dispatched documents thru courier

    Thank you god!!:) im done waiting :)

  • Siopao23Siopao23 North Ryde
    Posts: 759Member
    Joined: Apr 19, 2013
    Nandito ako ngayon sa nationwide sinabi sa akin ng doctor 1 to 2 weeks daw ito. Ganun ba katagal?

    "IF YOU ASK ANYTHING IN MY NAME, I WILL DO IT".

    John 14:14

    Loving Lord!The Scripture says that You are aware of all our needs, even before we ask You. So I come to You and place this request at Your loving hands.You know how desperate I am for getting the Visa. My soul has become weary and anxious over this delay in getting the visa .O Lord! Speak in the hearts of the concerned officials, grant me favour in their eyes and help me to get my visa on time so that my purpose is fulfilled. Perfect everything for me my Master. I wait at Your feet and trust in You to make this possible. I know that You will do it for You will never let Your children down. I thank You for listening to my plea! To You alone be all honour and glory. In the sweet name of Jesus I pray.Amen.

  • Siopao23Siopao23 North Ryde
    Posts: 759Member
    Joined: Apr 19, 2013
    I mean ung pag send sa DIAC

    "IF YOU ASK ANYTHING IN MY NAME, I WILL DO IT".

    John 14:14

    Loving Lord!The Scripture says that You are aware of all our needs, even before we ask You. So I come to You and place this request at Your loving hands.You know how desperate I am for getting the Visa. My soul has become weary and anxious over this delay in getting the visa .O Lord! Speak in the hearts of the concerned officials, grant me favour in their eyes and help me to get my visa on time so that my purpose is fulfilled. Perfect everything for me my Master. I wait at Your feet and trust in You to make this possible. I know that You will do it for You will never let Your children down. I thank You for listening to my plea! To You alone be all honour and glory. In the sweet name of Jesus I pray.Amen.

  • maliboomaliboo Davao City
    Posts: 233Member
    Joined: Jun 11, 2013
    @siopao huwat?!? Sken 2days after naupload na..bkt daw?ang tagal. Pro sbe nmn sken dti 1wk dw pro aun npaaga pro 2wks is too long ata

    Subclass 573 (SVP) commencement date Aug 12
    May 21 - lodged visa application
    May 23 - DIAC acknowledged application
    May 31 - Medicals NHSI
    June 4 - NHSI submitted results
    June 10 - Medicals referred to MOC June 4
    June 25 - was informed we needed addtl tests for hubby
    June 28 - hubby's meds uploaded and referred to HOC AUSTRALIA
    June 23 - received email from DIAC stating "we have recently received your husbands medical clearance".
    Aug 1 - request form 815 health undertaking passed it on the same day :)
    Aug 5 - emailed diac that i have to be able to attend uni on the 12th otherwise i would need to defer my course.
    Aug 6 - they might have read my email and issued a grant at 2pm
    Aug 7 - received sms that they have dispatched documents thru courier

    Thank you god!!:) im done waiting :)

  • Siopao23Siopao23 North Ryde
    Posts: 759Member
    Joined: Apr 19, 2013
    @maliboo baka yun ang expected timeframe nila pero baka ma upload din agad.

    "IF YOU ASK ANYTHING IN MY NAME, I WILL DO IT".

    John 14:14

    Loving Lord!The Scripture says that You are aware of all our needs, even before we ask You. So I come to You and place this request at Your loving hands.You know how desperate I am for getting the Visa. My soul has become weary and anxious over this delay in getting the visa .O Lord! Speak in the hearts of the concerned officials, grant me favour in their eyes and help me to get my visa on time so that my purpose is fulfilled. Perfect everything for me my Master. I wait at Your feet and trust in You to make this possible. I know that You will do it for You will never let Your children down. I thank You for listening to my plea! To You alone be all honour and glory. In the sweet name of Jesus I pray.Amen.

  • acelechi15acelechi15 Woolloongabba
    Posts: 134Member
    Joined: Jul 29, 2013
    @maliboo Just called IDP na rin. Wala pa raw sa system nila, pwede ko naman daw print yung acceptance form then sign and scan it then send it thru email. And yes, medyo malayo ako sa IDP kasi sa QC ako. Hihihi! :)

    @siopao yun lang ang sinasabi nila pero maaga yun mapapadala within a week lang. No worries. :)
  • Siopao23Siopao23 North Ryde
    Posts: 759Member
    Joined: Apr 19, 2013
    @acelechi15 thanks . Tapos na ako bilis lang pala . Magsisimba ako sa greenbelt sama ko kayo lahat sa prayers ko

    "IF YOU ASK ANYTHING IN MY NAME, I WILL DO IT".

    John 14:14

    Loving Lord!The Scripture says that You are aware of all our needs, even before we ask You. So I come to You and place this request at Your loving hands.You know how desperate I am for getting the Visa. My soul has become weary and anxious over this delay in getting the visa .O Lord! Speak in the hearts of the concerned officials, grant me favour in their eyes and help me to get my visa on time so that my purpose is fulfilled. Perfect everything for me my Master. I wait at Your feet and trust in You to make this possible. I know that You will do it for You will never let Your children down. I thank You for listening to my plea! To You alone be all honour and glory. In the sweet name of Jesus I pray.Amen.

  • acelechi15acelechi15 Woolloongabba
    Posts: 134Member
    Joined: Jul 29, 2013
    @Siopao23 thank you!!! ;)
  • Siopao23Siopao23 North Ryde
    Posts: 759Member
    Joined: Apr 19, 2013
    @acelechi15 welcome isa na ako sa mga maghihintay ng visa grant. Now i know how it feels hehehehe

    "IF YOU ASK ANYTHING IN MY NAME, I WILL DO IT".

    John 14:14

    Loving Lord!The Scripture says that You are aware of all our needs, even before we ask You. So I come to You and place this request at Your loving hands.You know how desperate I am for getting the Visa. My soul has become weary and anxious over this delay in getting the visa .O Lord! Speak in the hearts of the concerned officials, grant me favour in their eyes and help me to get my visa on time so that my purpose is fulfilled. Perfect everything for me my Master. I wait at Your feet and trust in You to make this possible. I know that You will do it for You will never let Your children down. I thank You for listening to my plea! To You alone be all honour and glory. In the sweet name of Jesus I pray.Amen.

  • KG2KG2 Darwin
    Posts: 380Member
    Joined: May 07, 2013
    @acelechi15 - opo, email niyo yung may "info" sa address nang IDP. pero ako dati sinabihan ko lang talaga sa school na dapat kasama ako sa loop nang email.
    @maliboo makaka habol pa po ba kayo? wala nang HU sa wife na medicals ko. Clearance na dumating sa CO.



    Destination: Darwin
    School: CDU(Jul 15, 2013 intake) up to Aug 5, 2013

            Sept 13 - IELTS passed(8 overall)
            <span style="background-color:#00ff00;">April 8, 2013 - Lodged Visa Subclass 573 thru IDP-L1-SVP&nbsp;</span>
            April 15, 2013 - medical exam at NHSI Cebu
            <span style="background-color:#00ff00;">April 16, 2013 - wife for repeat UA with FBS and creatinine&nbsp;</span>
            April 27, 2013 - medical of son and me forwarded to Global Health(according to NHSI)
            <span style="background-color:#00ff00;">May 3, 2013 - medical of wife forwarded to GH(according to NHSI)&nbsp;</span>
            May 5, 2013 - DIAC said they are waiting for my wifes health clearance from GH
            <span style="background-color:#00ff00;">May 30, DIAC said that medical results of wife was referred to MOC&nbsp;</span>
            July 15, 2013, DIAC said that medical clearance received by CO
            <span style="background-color:#00ff00;">July 18, 2013 - DIAC requested for approval for late arrival&nbsp;</span>
    

    July 23 - grant, July 24 - email received with grant attached
    SOME HELPFUL LINKS(MOUSE OVER TO SEE TITLE)
    1 | 2 | 3 | 4 | 5


    If He gets you to it, He'll get you through it...
  • maliboomaliboo Davao City
    Posts: 233Member
    Joined: Jun 11, 2013
    @KG2 hnggng aug 19 p nman so ok pa daw sna hehe

    Subclass 573 (SVP) commencement date Aug 12
    May 21 - lodged visa application
    May 23 - DIAC acknowledged application
    May 31 - Medicals NHSI
    June 4 - NHSI submitted results
    June 10 - Medicals referred to MOC June 4
    June 25 - was informed we needed addtl tests for hubby
    June 28 - hubby's meds uploaded and referred to HOC AUSTRALIA
    June 23 - received email from DIAC stating "we have recently received your husbands medical clearance".
    Aug 1 - request form 815 health undertaking passed it on the same day :)
    Aug 5 - emailed diac that i have to be able to attend uni on the 12th otherwise i would need to defer my course.
    Aug 6 - they might have read my email and issued a grant at 2pm
    Aug 7 - received sms that they have dispatched documents thru courier

    Thank you god!!:) im done waiting :)

  • Siopao23Siopao23 North Ryde
    Posts: 759Member
    Joined: Apr 19, 2013
    @maliboo nakita mo ba results mo from nationwide at pano?

    "IF YOU ASK ANYTHING IN MY NAME, I WILL DO IT".

    John 14:14

    Loving Lord!The Scripture says that You are aware of all our needs, even before we ask You. So I come to You and place this request at Your loving hands.You know how desperate I am for getting the Visa. My soul has become weary and anxious over this delay in getting the visa .O Lord! Speak in the hearts of the concerned officials, grant me favour in their eyes and help me to get my visa on time so that my purpose is fulfilled. Perfect everything for me my Master. I wait at Your feet and trust in You to make this possible. I know that You will do it for You will never let Your children down. I thank You for listening to my plea! To You alone be all honour and glory. In the sweet name of Jesus I pray.Amen.

  • maliboomaliboo Davao City
    Posts: 233Member
    Joined: Jun 11, 2013
    @siopao hindi eh pro alm ko u can ask for a copy :)

    Subclass 573 (SVP) commencement date Aug 12
    May 21 - lodged visa application
    May 23 - DIAC acknowledged application
    May 31 - Medicals NHSI
    June 4 - NHSI submitted results
    June 10 - Medicals referred to MOC June 4
    June 25 - was informed we needed addtl tests for hubby
    June 28 - hubby's meds uploaded and referred to HOC AUSTRALIA
    June 23 - received email from DIAC stating "we have recently received your husbands medical clearance".
    Aug 1 - request form 815 health undertaking passed it on the same day :)
    Aug 5 - emailed diac that i have to be able to attend uni on the 12th otherwise i would need to defer my course.
    Aug 6 - they might have read my email and issued a grant at 2pm
    Aug 7 - received sms that they have dispatched documents thru courier

    Thank you god!!:) im done waiting :)

  • tenseakotenseako Brisbane
    Posts: 227Member
    Joined: Mar 22, 2013
    @Siopao23 sabi lang nila yun pero 2days lang naupload na nila yung akin.. :)

    Subclass 573 - SVP
    ELICOS for 12 weeks + BS Nursing
    ELICOS commencing on October 24, 2013

    April 15 2013 - letter offer from QUT
    June 3, 2013 - paid tuition fee
    June 10, 2013 - accepted offer
    June 20, 2013 - eCOE given
    June 26, 2013 - visa lodge via IDP
    June 27, 2013 - visa lodgment confirmation text received
    July 2, 2013 - informed for medical
    July 3, 2013 - medicals done
    July 5, 2013 - medicals uploaded. NHSI informed me that there's no need for additional tests.
    July 6, 2013 - medical results referred to MOC, informed that decision will be made after approximately 8 weeks from the date of referral.
    August 13, 2013 - embassy informed me that my medical clearance was issued and will strive to finalize my visa as soon as possible.
    Augsut 16, 2013 - VISA GRANT! :D
    August 17, 2013 - received a text message from DIAC that my passport/documents was dispatched to the courier for delivery

    "No pain, No gain."

  • acelechi15acelechi15 Woolloongabba
    Posts: 134Member
    Joined: Jul 29, 2013
    @Siopao23 just email them after 3 days re your medical result. They'll respond naman agad. Good luck! :-)
  • acelechi15acelechi15 Woolloongabba
    Posts: 134Member
    Joined: Jul 29, 2013
    @KG2 yes naemail ko naman sila. Kasama rin ako sa loop, hindi pa lang talaga dumarating yung email sa hindi ko malaman na reason. :( tumawag ako sa school naemail na daw nila. Nagpa-email ako ulit wala parin.
  • KG2KG2 Darwin
    Posts: 380Member
    Joined: May 07, 2013
    @acelechi15 na try niyo na i check sa spam? search niyo ang domain nang email?



    Destination: Darwin
    School: CDU(Jul 15, 2013 intake) up to Aug 5, 2013

            Sept 13 - IELTS passed(8 overall)
            <span style="background-color:#00ff00;">April 8, 2013 - Lodged Visa Subclass 573 thru IDP-L1-SVP&nbsp;</span>
            April 15, 2013 - medical exam at NHSI Cebu
            <span style="background-color:#00ff00;">April 16, 2013 - wife for repeat UA with FBS and creatinine&nbsp;</span>
            April 27, 2013 - medical of son and me forwarded to Global Health(according to NHSI)
            <span style="background-color:#00ff00;">May 3, 2013 - medical of wife forwarded to GH(according to NHSI)&nbsp;</span>
            May 5, 2013 - DIAC said they are waiting for my wifes health clearance from GH
            <span style="background-color:#00ff00;">May 30, DIAC said that medical results of wife was referred to MOC&nbsp;</span>
            July 15, 2013, DIAC said that medical clearance received by CO
            <span style="background-color:#00ff00;">July 18, 2013 - DIAC requested for approval for late arrival&nbsp;</span>
    

    July 23 - grant, July 24 - email received with grant attached
    SOME HELPFUL LINKS(MOUSE OVER TO SEE TITLE)
    1 | 2 | 3 | 4 | 5


    If He gets you to it, He'll get you through it...
  • tenseakotenseako Brisbane
    Posts: 227Member
    Joined: Mar 22, 2013
    @maliboo wala e.. naririnig rinig ko lang din.. hehe. mgtanong din tayo dun malay natin mas oks pala sa knila.

    Subclass 573 - SVP
    ELICOS for 12 weeks + BS Nursing
    ELICOS commencing on October 24, 2013

    April 15 2013 - letter offer from QUT
    June 3, 2013 - paid tuition fee
    June 10, 2013 - accepted offer
    June 20, 2013 - eCOE given
    June 26, 2013 - visa lodge via IDP
    June 27, 2013 - visa lodgment confirmation text received
    July 2, 2013 - informed for medical
    July 3, 2013 - medicals done
    July 5, 2013 - medicals uploaded. NHSI informed me that there's no need for additional tests.
    July 6, 2013 - medical results referred to MOC, informed that decision will be made after approximately 8 weeks from the date of referral.
    August 13, 2013 - embassy informed me that my medical clearance was issued and will strive to finalize my visa as soon as possible.
    Augsut 16, 2013 - VISA GRANT! :D
    August 17, 2013 - received a text message from DIAC that my passport/documents was dispatched to the courier for delivery

    "No pain, No gain."

  • tenseakotenseako Brisbane
    Posts: 227Member
    Joined: Mar 22, 2013
    @maliboo hi! ask ko lang sino nginform sa inyo na need ng additional tests ng hubby mo? si IDP ba o direcho na immi? if im not mistaken na-inform muna kayo na referred sa MOC ung medical before kayo hiningian ng additional tests db?

    Subclass 573 - SVP
    ELICOS for 12 weeks + BS Nursing
    ELICOS commencing on October 24, 2013

    April 15 2013 - letter offer from QUT
    June 3, 2013 - paid tuition fee
    June 10, 2013 - accepted offer
    June 20, 2013 - eCOE given
    June 26, 2013 - visa lodge via IDP
    June 27, 2013 - visa lodgment confirmation text received
    July 2, 2013 - informed for medical
    July 3, 2013 - medicals done
    July 5, 2013 - medicals uploaded. NHSI informed me that there's no need for additional tests.
    July 6, 2013 - medical results referred to MOC, informed that decision will be made after approximately 8 weeks from the date of referral.
    August 13, 2013 - embassy informed me that my medical clearance was issued and will strive to finalize my visa as soon as possible.
    Augsut 16, 2013 - VISA GRANT! :D
    August 17, 2013 - received a text message from DIAC that my passport/documents was dispatched to the courier for delivery

    "No pain, No gain."

  • Siopao23Siopao23 North Ryde
    Posts: 759Member
    Joined: Apr 19, 2013
    @tenseako normally anong mga additional test ang kailangan sa medical exam?

    "IF YOU ASK ANYTHING IN MY NAME, I WILL DO IT".

    John 14:14

    Loving Lord!The Scripture says that You are aware of all our needs, even before we ask You. So I come to You and place this request at Your loving hands.You know how desperate I am for getting the Visa. My soul has become weary and anxious over this delay in getting the visa .O Lord! Speak in the hearts of the concerned officials, grant me favour in their eyes and help me to get my visa on time so that my purpose is fulfilled. Perfect everything for me my Master. I wait at Your feet and trust in You to make this possible. I know that You will do it for You will never let Your children down. I thank You for listening to my plea! To You alone be all honour and glory. In the sweet name of Jesus I pray.Amen.

  • tenseakotenseako Brisbane
    Posts: 227Member
    Joined: Mar 22, 2013
    @Siopao23 depende sa case mo yun e. kung ano ung hindi normal sa results mo. more on, double check and check the underlying cause to prove that your health is okay despite of abnormal results.

    Subclass 573 - SVP
    ELICOS for 12 weeks + BS Nursing
    ELICOS commencing on October 24, 2013

    April 15 2013 - letter offer from QUT
    June 3, 2013 - paid tuition fee
    June 10, 2013 - accepted offer
    June 20, 2013 - eCOE given
    June 26, 2013 - visa lodge via IDP
    June 27, 2013 - visa lodgment confirmation text received
    July 2, 2013 - informed for medical
    July 3, 2013 - medicals done
    July 5, 2013 - medicals uploaded. NHSI informed me that there's no need for additional tests.
    July 6, 2013 - medical results referred to MOC, informed that decision will be made after approximately 8 weeks from the date of referral.
    August 13, 2013 - embassy informed me that my medical clearance was issued and will strive to finalize my visa as soon as possible.
    Augsut 16, 2013 - VISA GRANT! :D
    August 17, 2013 - received a text message from DIAC that my passport/documents was dispatched to the courier for delivery

    "No pain, No gain."

  • acelechi15acelechi15 Woolloongabba
    Posts: 134Member
    Joined: Jul 29, 2013
    Finally nakita ko sa spam. Thank god! :) thanks sa advice @KG2. Nasa Aussie na po ba kayo?
  • Siopao23Siopao23 North Ryde
    Posts: 759Member
    Joined: Apr 19, 2013
    @tenseako i see. Para kasi ang bilis. Xray tapos physical exam tapos urinalysis ata yun tapos wala na

    "IF YOU ASK ANYTHING IN MY NAME, I WILL DO IT".

    John 14:14

    Loving Lord!The Scripture says that You are aware of all our needs, even before we ask You. So I come to You and place this request at Your loving hands.You know how desperate I am for getting the Visa. My soul has become weary and anxious over this delay in getting the visa .O Lord! Speak in the hearts of the concerned officials, grant me favour in their eyes and help me to get my visa on time so that my purpose is fulfilled. Perfect everything for me my Master. I wait at Your feet and trust in You to make this possible. I know that You will do it for You will never let Your children down. I thank You for listening to my plea! To You alone be all honour and glory. In the sweet name of Jesus I pray.Amen.

  • Siopao23Siopao23 North Ryde
    Posts: 759Member
    Joined: Apr 19, 2013
    Sana maayos lahat

    "IF YOU ASK ANYTHING IN MY NAME, I WILL DO IT".

    John 14:14

    Loving Lord!The Scripture says that You are aware of all our needs, even before we ask You. So I come to You and place this request at Your loving hands.You know how desperate I am for getting the Visa. My soul has become weary and anxious over this delay in getting the visa .O Lord! Speak in the hearts of the concerned officials, grant me favour in their eyes and help me to get my visa on time so that my purpose is fulfilled. Perfect everything for me my Master. I wait at Your feet and trust in You to make this possible. I know that You will do it for You will never let Your children down. I thank You for listening to my plea! To You alone be all honour and glory. In the sweet name of Jesus I pray.Amen.

  • tenseakotenseako Brisbane
    Posts: 227Member
    Joined: Mar 22, 2013
    @Siopao23 oo kasi yun lang request sayo. :) yung mga medical allied usually my HIV, Hepa A and B pa. like ako. :) pero mabilis lang talaga lalo na pag wlang tao. :)

    Subclass 573 - SVP
    ELICOS for 12 weeks + BS Nursing
    ELICOS commencing on October 24, 2013

    April 15 2013 - letter offer from QUT
    June 3, 2013 - paid tuition fee
    June 10, 2013 - accepted offer
    June 20, 2013 - eCOE given
    June 26, 2013 - visa lodge via IDP
    June 27, 2013 - visa lodgment confirmation text received
    July 2, 2013 - informed for medical
    July 3, 2013 - medicals done
    July 5, 2013 - medicals uploaded. NHSI informed me that there's no need for additional tests.
    July 6, 2013 - medical results referred to MOC, informed that decision will be made after approximately 8 weeks from the date of referral.
    August 13, 2013 - embassy informed me that my medical clearance was issued and will strive to finalize my visa as soon as possible.
    Augsut 16, 2013 - VISA GRANT! :D
    August 17, 2013 - received a text message from DIAC that my passport/documents was dispatched to the courier for delivery

    "No pain, No gain."

  • maliboomaliboo Davao City
    Posts: 233Member
    Joined: Jun 11, 2013
    @tenseako hndi naupload kc kulang :(

    Subclass 573 (SVP) commencement date Aug 12
    May 21 - lodged visa application
    May 23 - DIAC acknowledged application
    May 31 - Medicals NHSI
    June 4 - NHSI submitted results
    June 10 - Medicals referred to MOC June 4
    June 25 - was informed we needed addtl tests for hubby
    June 28 - hubby's meds uploaded and referred to HOC AUSTRALIA
    June 23 - received email from DIAC stating "we have recently received your husbands medical clearance".
    Aug 1 - request form 815 health undertaking passed it on the same day :)
    Aug 5 - emailed diac that i have to be able to attend uni on the 12th otherwise i would need to defer my course.
    Aug 6 - they might have read my email and issued a grant at 2pm
    Aug 7 - received sms that they have dispatched documents thru courier

    Thank you god!!:) im done waiting :)

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

angelo3416cubarolrkanini3alvinjoshuacwohobo7842hazelijamasRomy0421Londino34greamreaper24jackmart2bruce22tzailyrammurilloJustin32Chuy92mikelachica777morganccemmancpparkerkhanwenggaygay
Browse Members

Members Online (0) + Guest (106)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌