Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

States Invitations and Nomination Matters for FY 2024-2025

16062646566

Comments

  • cp101030cp101030 singapore
    Posts: 105Member
    Joined: Oct 23, 2016

    Hi Guys, any wfh po dito n hndi ngbbyad yung company ng SSS, Pag-ibig nor tax s pinas and on our own ang byad. How did you handle po if mgrequest neto si DHA once invited?

  • casssiecasssie ✨🦘✨
    Posts: 819Member
    Joined: Nov 15, 2022

    @cp101030 said:
    Hi Guys, any wfh po dito n hndi ngbbyad yung company ng SSS, Pag-ibig nor tax s pinas and on our own ang byad. How did you handle po if mgrequest neto si DHA once invited?

    i used to pay voluntarily sa bayad centers before. gawa ka ng online account so you can check your payments. once may account ka na, screenshot mo lang yung buong web page to show your contributions including months, year, etc.

    actually, sa skills assessment pa lang, under payment evidence, kelangan mo na ipakita yung taxes and gov't contributions. (at least for ACS)

    OzdrimsCantThinkAnyUserNamecp101030fmp_921

    m(au)nifesting 🇦🇺
    261312 Developer Programmer / 90 points
    ~
    25 Oct 2023 - EOI SC 190
    16 Nov 2023 - Pre-invite NSW
    24 Nov 2023 - ITA
    29 Nov 2023 - Lodged
    20 Mar 2025 - GRANTED ✨

  • cp101030cp101030 singapore
    Posts: 105Member
    Joined: Oct 23, 2016

    Huge thanks Cassie. Ok lng po b to khit wala pong company name s contributions page po?

  • taniamarkovataniamarkova Posts: 41Member
    Joined: Jun 25, 2020

    @cp101030 said:
    Huge thanks Cassie. Ok lng po b to khit wala pong company name s contributions page po?

    Just chiming in. Siguro mas safe po talaga kung may employer's name at employment history, kasi naka received ako ng 2 s56s about employment verification (after ko mag upload ng ITRs at screenshots ng SSS employment contributions and employment history) naka recevied pa din ako ng s56 - Consent to Disclose Information with Waiver of Rights and Indemnity Undertaking, for SSS to disclose my information and data to DHA. :#

    casssie

    Architectural Draftsperson (312111) | Age: 25 | English Ability: 20 | Education: 15 | Skilled Employment: 10 | Partner: 10
    EOI: (updated) 05 March 2023
    Pre-ITA: 29 March 2023
    ITA: 31 March 2023 (NSW 491)
    Lodgement: 21 May 2023
    Biometrics & Medical: 26 May 2023
    1st s56: 16 October 2023 (Submitted 11 November 2023)
    2nd s56: 24 May 2024 (Submitted same day)
    3rd s56: 26 July 2024 (Submitted 30 July 2024)
    4th s56: 20 January 2025 (re-medical)
    5th s56: 02 June 2025 (health undertaking)
    Visa Grant: 10 July 2025

  • MidnightPanda12MidnightPanda12 Philippines
    Posts: 287Member
    Joined: May 23, 2020

    @taniamarkova said:

    @cp101030 said:
    Huge thanks Cassie. Ok lng po b to khit wala pong company name s contributions page po?

    Just chiming in. Siguro mas safe po talaga kung may employer's name at employment history, kasi naka received ako ng 2 s56s about employment verification (after ko mag upload ng ITRs at screenshots ng SSS employment contributions and employment history) naka recevied pa din ako ng s56 - Consent to Disclose Information with Waiver of Rights and Indemnity Undertaking, for SSS to disclose my information and data to DHA. :#

    Yung consent form po ay pinapirmahan po sa inyo ni DHA?

    DIY Journey. ✈️🇦🇺🦘 soooon
    Nominated Occupation > Agricultural Engineer


    Points Breakdown

    Age - 30 points | English - Superior 20 points| Qualifications (BS) - 15 points | Experience (8 yrs +) - 15 points | Single - 10 points = TOTAL POINTS > SC189 - 90 points; > SC190 - 95 points; SC491 - 105 points


    2023

    08.01.2023 - Started CDR Preparation
    08.25.2023 - Completed CDR/ CPD/ SS
    09.01.2023 - Start PTE Exam Preparation
    09.23.2023 - PTE Exam Proper
    09.23.2023 - PTE Result > L - 88 | R - 90 | S - 90 | W - 79 > Superior - 1 take only
    09.27.2023 - EA Skills Assessment Initial Document Upload (found some inconsistencies with date, had to postpone submission)
    09.28.2023 - EA Skills Assessment Submitted, RSEA + Fast Track
    10.18.2023 - EA Skills Assessment in Progress update
    11.08.2023 - EA Skills Assessment Outcome - POSITIVE with 6 yrs + RSEA
    11.08.2023 - Immediately Submitted EOI for SC 189 with 85 points
    11.09.2023 - Submitted EOI / ROI for SC190 with 90 points for NSW/ VIC/ SA


    HAPPY NEW YEAR!! 2024

    01.09.2024 - Submitted EOI for SC 491 for NSW with 100 points
    01.19.2024 - Edited All EOIs for SC 189/190/491 to reflect new position in work
    01.24.2024 - Withdrawn EOI 190 / ROI for SA, Resubmitted EOI 491 / ROI for SA
    07.25.2024 - Updated All EOIs for SC 189/190/491 to reflect promotion in work
    09.30.2024 - Booked NAATI Exam for extra +5 points (scheduled at 11.13.2024)
    10.08.2024 - INCREASE IN POINTS - 8 years working experience +5 points baby; EOI’s recalculated for SC189, SC190 - NSW/QLD, SC491 - VIC/ SA/ NSW/ QLD
    11.07.2024 - Invited to Apply - SC 189 ; Cancelled NAATI Exam.


    Received my invitation to apply exactly 365 days (leap year) after I submitted my EOI.


    11.09.2024 - LODGED - Visa Application for SC 189 🇦🇺
    11.09.2024 - Withdrawn all other EOIs (NSW/VIC/SA/QLD). EOI of SC189 is now LOCKED.
    11.18.2024 - Immigration Medical Exam at St. Lukes Extension Clinic BGC
    11.19.2024 - Attached Joint Affidavit of Two Disinterested Person for Birth Certificate Clerical Error re: Mother’s First Name
    11.19.2024 - Health Clearance Provided - No further actions required
    WAIT for the GOLDEN EMAIL 📧 BEGINS
    02.10.2025 - VISA GRANTED (no S56, direct grant) 🏆
    Granted after 3 months of waiting


    MOVE PREPARATION


    13.02.2025 - Job Hunt Begins ⛏️🌾
    17.02.2025 - Completed PDOS and acquired CFO Certificate
    24.04.2025 - Got a Job Offer in Regional NSW, Australia
    16.06.2025 - BIG MOVE ✈️


    ROAD TO CITIZENSHIP


    xx.xx.xxxx -

  • taniamarkovataniamarkova Posts: 41Member
    Joined: Jun 25, 2020

    @MidnightPanda12 said:

    @taniamarkova said:

    @cp101030 said:
    Huge thanks Cassie. Ok lng po b to khit wala pong company name s contributions page po?

    Just chiming in. Siguro mas safe po talaga kung may employer's name at employment history, kasi naka received ako ng 2 s56s about employment verification (after ko mag upload ng ITRs at screenshots ng SSS employment contributions and employment history) naka recevied pa din ako ng s56 - Consent to Disclose Information with Waiver of Rights and Indemnity Undertaking, for SSS to disclose my information and data to DHA. :#

    Yung consent form po ay pinapirmahan po sa inyo ni DHA?

    Yes po, and kailangan notarized.

    Ozdrims

    Architectural Draftsperson (312111) | Age: 25 | English Ability: 20 | Education: 15 | Skilled Employment: 10 | Partner: 10
    EOI: (updated) 05 March 2023
    Pre-ITA: 29 March 2023
    ITA: 31 March 2023 (NSW 491)
    Lodgement: 21 May 2023
    Biometrics & Medical: 26 May 2023
    1st s56: 16 October 2023 (Submitted 11 November 2023)
    2nd s56: 24 May 2024 (Submitted same day)
    3rd s56: 26 July 2024 (Submitted 30 July 2024)
    4th s56: 20 January 2025 (re-medical)
    5th s56: 02 June 2025 (health undertaking)
    Visa Grant: 10 July 2025

  • MidnightPanda12MidnightPanda12 Philippines
    Posts: 287Member
    Joined: May 23, 2020

    @taniamarkova said:

    @MidnightPanda12 said:

    @taniamarkova said:

    @cp101030 said:
    Huge thanks Cassie. Ok lng po b to khit wala pong company name s contributions page po?

    Just chiming in. Siguro mas safe po talaga kung may employer's name at employment history, kasi naka received ako ng 2 s56s about employment verification (after ko mag upload ng ITRs at screenshots ng SSS employment contributions and employment history) naka recevied pa din ako ng s56 - Consent to Disclose Information with Waiver of Rights and Indemnity Undertaking, for SSS to disclose my information and data to DHA. :#

    Yung consent form po ay pinapirmahan po sa inyo ni DHA?

    Yes po, and kailangan notarized.

    Sila po magsesend nyan sa inyo?

    Kasi I submitted SSS and Pagibig. Mayroon naman po nakalagay na employer dun sa screenshot po. Manghihingi pa din kaya sila ng consent form?

    DIY Journey. ✈️🇦🇺🦘 soooon
    Nominated Occupation > Agricultural Engineer


    Points Breakdown

    Age - 30 points | English - Superior 20 points| Qualifications (BS) - 15 points | Experience (8 yrs +) - 15 points | Single - 10 points = TOTAL POINTS > SC189 - 90 points; > SC190 - 95 points; SC491 - 105 points


    2023

    08.01.2023 - Started CDR Preparation
    08.25.2023 - Completed CDR/ CPD/ SS
    09.01.2023 - Start PTE Exam Preparation
    09.23.2023 - PTE Exam Proper
    09.23.2023 - PTE Result > L - 88 | R - 90 | S - 90 | W - 79 > Superior - 1 take only
    09.27.2023 - EA Skills Assessment Initial Document Upload (found some inconsistencies with date, had to postpone submission)
    09.28.2023 - EA Skills Assessment Submitted, RSEA + Fast Track
    10.18.2023 - EA Skills Assessment in Progress update
    11.08.2023 - EA Skills Assessment Outcome - POSITIVE with 6 yrs + RSEA
    11.08.2023 - Immediately Submitted EOI for SC 189 with 85 points
    11.09.2023 - Submitted EOI / ROI for SC190 with 90 points for NSW/ VIC/ SA


    HAPPY NEW YEAR!! 2024

    01.09.2024 - Submitted EOI for SC 491 for NSW with 100 points
    01.19.2024 - Edited All EOIs for SC 189/190/491 to reflect new position in work
    01.24.2024 - Withdrawn EOI 190 / ROI for SA, Resubmitted EOI 491 / ROI for SA
    07.25.2024 - Updated All EOIs for SC 189/190/491 to reflect promotion in work
    09.30.2024 - Booked NAATI Exam for extra +5 points (scheduled at 11.13.2024)
    10.08.2024 - INCREASE IN POINTS - 8 years working experience +5 points baby; EOI’s recalculated for SC189, SC190 - NSW/QLD, SC491 - VIC/ SA/ NSW/ QLD
    11.07.2024 - Invited to Apply - SC 189 ; Cancelled NAATI Exam.


    Received my invitation to apply exactly 365 days (leap year) after I submitted my EOI.


    11.09.2024 - LODGED - Visa Application for SC 189 🇦🇺
    11.09.2024 - Withdrawn all other EOIs (NSW/VIC/SA/QLD). EOI of SC189 is now LOCKED.
    11.18.2024 - Immigration Medical Exam at St. Lukes Extension Clinic BGC
    11.19.2024 - Attached Joint Affidavit of Two Disinterested Person for Birth Certificate Clerical Error re: Mother’s First Name
    11.19.2024 - Health Clearance Provided - No further actions required
    WAIT for the GOLDEN EMAIL 📧 BEGINS
    02.10.2025 - VISA GRANTED (no S56, direct grant) 🏆
    Granted after 3 months of waiting


    MOVE PREPARATION


    13.02.2025 - Job Hunt Begins ⛏️🌾
    17.02.2025 - Completed PDOS and acquired CFO Certificate
    24.04.2025 - Got a Job Offer in Regional NSW, Australia
    16.06.2025 - BIG MOVE ✈️


    ROAD TO CITIZENSHIP


    xx.xx.xxxx -

  • Cerberus13Cerberus13 Dublin Ireland
    Posts: 379Member
    Joined: Mar 23, 2020
    edited November 2024

    @taniamarkova said:

    @cp101030 said:
    Huge thanks Cassie. Ok lng po b to khit wala pong company name s contributions page po?

    Just chiming in. Siguro mas safe po talaga kung may employer's name at employment history, kasi naka received ako ng 2 s56s about employment verification (after ko mag upload ng ITRs at screenshots ng SSS employment contributions and employment history) naka recevied pa din ako ng s56 - Consent to Disclose Information with Waiver of Rights and Indemnity Undertaking, for SSS to disclose my information and data to DHA. :#

    Palaisipan pa rin for me kung anong type ng applicants ba ni rerequire ng s56, form80 and 1221. I never did these and never uploaded SSS and ITR hanggang sa na grant na lang visa ko. Feeling ko tuloy ma na miss akong step...

    fmp_921MidnightPanda12mathilde9taniamarkova

    ANZSCO 312111 - Architectural Draftsperson
    Location at the time of application: Offshore (Tokyo Japan) / DIY

    2020-Mar : Vetassess submission - Priority processing
    2020-Apr : Vetassess positive assessment - 5+ years employment
    2020-Jun 25 : First take PTE-A Tokyo - Superior
    2020-Jun : SkillSelect EOI lodge - 190/491 : 90/100 points

    2020 : Covid happened...

    2020-Aug : Job Offer - Ireland, Critical Skills Employment Permit path
    2020-Oct : Ireland Work permit granted
    2020-Oct : EOI auto updated due to age score dedcution - 190/491 : 85/95
    2020-Nov 18 : Ireland Employment Visa application
    2020-Nov 25 : Ireland work visa approved
    2020-Dec 26 : Moved to Dublin from Tokyo

    2022-Jun : EOI expired. New EOI lodged with no change in score
    2022-Aug : VIC opened for offshore. Lodged ROI for VIC
    2022-Sep : NSW opened for offshore. Created new EOI for NSW only
    2022-Sep : Removed 491 in my EOI. Only considering 190 for now
    2022-Nov 10 : Irish Stamp 4 status approved
    2022-Nov 29 : Received pre-ITA from NSW. Yay!
    2022-Nov 30 : Received nomination from NSW
    2023-Jan 13 : Visa 190 lodged
    2023-Feb 21 : Medicals
    2023-Feb 29 : Medicals cleared
    2023-Mar 15 : Japan PCC uploaded. Officially waiting for grant : )
    2023-Nov 23 : NSW 190 granted!

  • taniamarkovataniamarkova Posts: 41Member
    Joined: Jun 25, 2020

    @MidnightPanda12 said:

    @taniamarkova said:

    @MidnightPanda12 said:

    @taniamarkova said:

    @cp101030 said:
    Huge thanks Cassie. Ok lng po b to khit wala pong company name s contributions page po?

    Just chiming in. Siguro mas safe po talaga kung may employer's name at employment history, kasi naka received ako ng 2 s56s about employment verification (after ko mag upload ng ITRs at screenshots ng SSS employment contributions and employment history) naka recevied pa din ako ng s56 - Consent to Disclose Information with Waiver of Rights and Indemnity Undertaking, for SSS to disclose my information and data to DHA. :#

    Yung consent form po ay pinapirmahan po sa inyo ni DHA?

    Yes po, and kailangan notarized.

    Sila po magsesend nyan sa inyo?

    Kasi I submitted SSS and Pagibig. Mayroon naman po nakalagay na employer dun sa screenshot po. Manghihingi pa din kaya sila ng consent form?

    Yes sila po magssend. Siguro case to case basis talaga, tapos depende sa mood ng COs nung araw na na-open nila ang application mo, kung convinced na ba sila or hindi pa. HAHA

    Architectural Draftsperson (312111) | Age: 25 | English Ability: 20 | Education: 15 | Skilled Employment: 10 | Partner: 10
    EOI: (updated) 05 March 2023
    Pre-ITA: 29 March 2023
    ITA: 31 March 2023 (NSW 491)
    Lodgement: 21 May 2023
    Biometrics & Medical: 26 May 2023
    1st s56: 16 October 2023 (Submitted 11 November 2023)
    2nd s56: 24 May 2024 (Submitted same day)
    3rd s56: 26 July 2024 (Submitted 30 July 2024)
    4th s56: 20 January 2025 (re-medical)
    5th s56: 02 June 2025 (health undertaking)
    Visa Grant: 10 July 2025

  • cp101030cp101030 singapore
    Posts: 105Member
    Joined: Oct 23, 2016

    Oh gosh thank you for sharing. Sadly hndi dw ngpprocess hr nmn kc walang office ung company s ph. Pwede k n lng gwin is self contribution:(

  • cp101030cp101030 singapore
    Posts: 105Member
    Joined: Oct 23, 2016

    Hi guys, may nainvite n po b recently s NSW? Any ICT jobs po? Thank you

  • cp101030cp101030 singapore
    Posts: 105Member
    Joined: Oct 23, 2016

    Any idea if my invite si Vic for ICT under 491?

  • casssiecasssie ✨🦘✨
    Posts: 819Member
    Joined: Nov 15, 2022

    @cp101030 said:
    Any idea if my invite si Vic for ICT under 491?

    m(au)nifesting 🇦🇺
    261312 Developer Programmer / 90 points
    ~
    25 Oct 2023 - EOI SC 190
    16 Nov 2023 - Pre-invite NSW
    24 Nov 2023 - ITA
    29 Nov 2023 - Lodged
    20 Mar 2025 - GRANTED ✨

  • casssiecasssie ✨🦘✨
    Posts: 819Member
    Joined: Nov 15, 2022
    edited November 2024

    @cp101030 said:
    Hi guys, may nainvite n po b recently s NSW? Any ICT jobs po? Thank you



    wala pang nov round si NSW. hopefully next week!

    https://smartvisaguide.com/timeline/ - SUPER HELPFUL WEBSITE ⭐⭐⭐

    OzdrimsCantThinkAnyUserName

    m(au)nifesting 🇦🇺
    261312 Developer Programmer / 90 points
    ~
    25 Oct 2023 - EOI SC 190
    16 Nov 2023 - Pre-invite NSW
    24 Nov 2023 - ITA
    29 Nov 2023 - Lodged
    20 Mar 2025 - GRANTED ✨

  • cp101030cp101030 singapore
    Posts: 105Member
    Joined: Oct 23, 2016

    Any ofw po n walang office po ung company ksi remote lng cla? for location s eoi, yung country where you are residing po ba nlagay nyo? thanks po

  • Cerberus13Cerberus13 Dublin Ireland
    Posts: 379Member
    Joined: Mar 23, 2020

    @cp101030 said:
    Any ofw po n walang office po ung company ksi remote lng cla? for location s eoi, yung country where you are residing po ba nlagay nyo? thanks po

    Parang impossible na walang address ang company kahit remote ang workers. Sa website nila wala bang address kahit virtual address? They need an address when they file for their business tax, unless illegal sila. lol.

    Yes sa EOI, current address mo is kung saan ka nakatira na country.

    mathilde9cp101030

    ANZSCO 312111 - Architectural Draftsperson
    Location at the time of application: Offshore (Tokyo Japan) / DIY

    2020-Mar : Vetassess submission - Priority processing
    2020-Apr : Vetassess positive assessment - 5+ years employment
    2020-Jun 25 : First take PTE-A Tokyo - Superior
    2020-Jun : SkillSelect EOI lodge - 190/491 : 90/100 points

    2020 : Covid happened...

    2020-Aug : Job Offer - Ireland, Critical Skills Employment Permit path
    2020-Oct : Ireland Work permit granted
    2020-Oct : EOI auto updated due to age score dedcution - 190/491 : 85/95
    2020-Nov 18 : Ireland Employment Visa application
    2020-Nov 25 : Ireland work visa approved
    2020-Dec 26 : Moved to Dublin from Tokyo

    2022-Jun : EOI expired. New EOI lodged with no change in score
    2022-Aug : VIC opened for offshore. Lodged ROI for VIC
    2022-Sep : NSW opened for offshore. Created new EOI for NSW only
    2022-Sep : Removed 491 in my EOI. Only considering 190 for now
    2022-Nov 10 : Irish Stamp 4 status approved
    2022-Nov 29 : Received pre-ITA from NSW. Yay!
    2022-Nov 30 : Received nomination from NSW
    2023-Jan 13 : Visa 190 lodged
    2023-Feb 21 : Medicals
    2023-Feb 29 : Medicals cleared
    2023-Mar 15 : Japan PCC uploaded. Officially waiting for grant : )
    2023-Nov 23 : NSW 190 granted!

  • cp101030cp101030 singapore
    Posts: 105Member
    Joined: Oct 23, 2016

    Hi Guys, any idea if strict po si SA sa EOI? I actually created 2 EOI for 190 and 491 recently for the same anzcode. It was actually just 1 EOI before for both pero inisplit k lng recently. I saw some invites for Software Engineer coming from SA and we have the same score and same profile like age (25 pts), english (20). The only difference is may NAATI cia and walang skills assessment partner nya. Wala pa akong NAATI, will be taking this Dec 12 p lng and my partner is skilled (same profession). My impact po kaya yung pgsplit k ng EOI? Sana next na tyo mainvite.

  • cp101030cp101030 singapore
    Posts: 105Member
    Joined: Oct 23, 2016

    Hi Guys, my another 189 round p po kaya for this fy? Thanks po

  • ComplexComplex Posts: 46Member
    Joined: Mar 30, 2023

    Rough Calcs on Subclass 190
    14610 (~44%) of Planning Level (33000) consumed as at 31 Oct 2024
    Remaining: 18390 Planning Level.
    Assuming 20% will be consumed by new priority grants (granted quick), so ~15000 planning level remaining available to clear non-priority backlog.
    Backlog till Oct 2023 lodgements is roughly 15000.
    Therefore, we can expect to see grants till Sep/Oct 2023 lodgements in this FY. Rest depends on how they "spread out", we might even see a tiny trickle from Oct/Nov/Dec 2023 lodgements too.

    -Gregor Mendel
    https://www.facebook.com/groups/australiavisagrants/posts/1212609156497905/

    Ozdrimsmathilde9CantThinkAnyUserNamemanifestingvisagrantIsaiah2408cp101030

    ANZSCO 262111 Database Administrator (Offshore)

    Age: 25 | English: 20 | Experience: 15 | Education: 15 | Partner Qualifications: 5 | State: 190: 5 | TOTAL: 190 = 85

    Australia PR (Subclass 190) Timeline

    2022
    October 20, 2022 – Started Consultation with Visa Consort

    2023
    March 21, 2023 – Submitted Skills Assessment Application
    June 27, 2023 – Skills Assessment Outcome: Suitable for Migration
    April 25, 2023 – Main Applicant PTE (Result: Superior)
    May 9, 2023 – De Facto Partner PTE (Result: Proficient)
    September 29, 2023 – Submitted Expression of Interest NSW 190
    November 16, 2023 – Received Pre-invite from State
    December 11, 2023 – Received Nomination Approval from State

    2024
    January 19, 2024 – Submitted Visa Application
    January 26, 2024 – Completed Initial Visa Medicals at St. Luke’s Medical Center – Ermita

    2025
    January 17, 2025 – Proactively Submitted Latest PCC
    April 11, 2025 – Received S56 Request (Re-medicals for all applicants, Child turned 2 – TB Test required)
    April 14, 2025 – Completed 2nd Visa Medicals at St. Luke’s Medical Center – Ermita
    April 18, 2025 – Bupa Requested Further Medical Info (Hepa B Test for Main Applicant only)
    April 23, 2025 – Completed Hepa B Surface Antigen Test
    May 12, 2025 – VISA GRANTED! 🎉
    August 3, 2025 – BIG MOVE! 🎉

  • mathilde9mathilde9 NSW
    Posts: 1,094Member, Moderator
    Joined: Nov 15, 2021

    @Complex said:
    Rough Calcs on Subclass 190
    14610 (~44%) of Planning Level (33000) consumed as at 31 Oct 2024
    Remaining: 18390 Planning Level.
    Assuming 20% will be consumed by new priority grants (granted quick), so ~15000 planning level remaining available to clear non-priority backlog.
    Backlog till Oct 2023 lodgements is roughly 15000.
    Therefore, we can expect to see grants till Sep/Oct 2023 lodgements in this FY. Rest depends on how they "spread out", we might even see a tiny trickle from Oct/Nov/Dec 2023 lodgements too.

    -Gregor Mendel
    https://www.facebook.com/groups/australiavisagrants/posts/1212609156497905/

    Maubos na kayong mga 2023 lodgement please lang. Haha!

    MidnightPanda12cubebr00dling365manifestingvisagrantOzdrimsfmp_921

    OCCUPATION : SOFTWARE ENGINEER (261313) ~~ DIY. Offshore. Direct Grant
    Total Points ~~ NSW SC190: 90pts
    Points Breakdown:
    Age:25 | English:20 | Employment:15 | Education:15 | Single:10
    Been to Australia a few times and I just wanted to settle there. "I belong here" ganon.
    ~~~~
    10 2021 - Research about AU migration; read a lot of related articles; consulted with agent for initial assessment. Decided to DIY.
    11 2021 - PTE (Proficient)
    11 2021 - Suitable ACS Skills Assessment received (8+ years suitable, 5weeks 4days TAT)
    ~~~~
    01 2022 - EOIs submitted (matumal and slight hiatus since na-busy sa ibang bagay)
    ~~~~
    09 2023 - PTE retake (Superior 90 overall)
    09 2023 - Updated EOIs to reflect +10pts on English Test
    11 2023 - ACS Assessment expired T_T (but already prepared for re-assessment a few weeks before)
    11 2023 - ACS deemed my skills unsuitable because of missing documents. Nilaban ko.
    12 2023 - Suitable ACS Skills reassessment (8+ years) after 1month of review and pangungulit (no fee incurred, fault nila)
    12 2023 - Some EOIs expired T_T
    12 2023 - New EOIs submitted (NSW, VIC, ACT, and 189)
    ~~~~
    02 2024 - Booked NAATI Exam (desperate to max out point for a chance of invite)
    02 2024 - Received NSW 190 pre-invite!! ✩₊˚ (tears of joy, TYL! ). Cancelled NAATI test at 75% refund.
    02 2024 - Final NSW ITA received after 1 business day ✩₊˚
    02 2024 - Visa Lodgment
    02 2024 - Medicals. Cleared after 1 business day @ SATA AMK
    02 2024 - Singapore Police Clearance. Completed/claimed after 6 business days
    04 2025 - ** ✩₊˚.⋆☾⋆⁺₊✧ ** Visa Granted! TYL ** ✩₊˚.⋆☾⋆⁺₊✧ **

  • cp101030cp101030 singapore
    Posts: 105Member
    Joined: Oct 23, 2016

    Guys my invite dw po si NSW today. Congrats po s mga nainvite!!! :)

    cubeCantThinkAnyUserNamekatebae
  • MidnightPanda12MidnightPanda12 Philippines
    Posts: 287Member
    Joined: May 23, 2020

    @mathilde9 said:

    @Complex said:
    Rough Calcs on Subclass 190
    14610 (~44%) of Planning Level (33000) consumed as at 31 Oct 2024
    Remaining: 18390 Planning Level.
    Assuming 20% will be consumed by new priority grants (granted quick), so ~15000 planning level remaining available to clear non-priority backlog.
    Backlog till Oct 2023 lodgements is roughly 15000.
    Therefore, we can expect to see grants till Sep/Oct 2023 lodgements in this FY. Rest depends on how they "spread out", we might even see a tiny trickle from Oct/Nov/Dec 2023 lodgements too.

    -Gregor Mendel
    https://www.facebook.com/groups/australiavisagrants/posts/1212609156497905/

    Maubos na kayong mga 2023 lodgement please lang. Haha!

    Not sure if nakita niyo na to, from Australia Immigration Matters FB page.

    Quite helpful since we had a big 189 invitation and you can also see na tumaas din yung closed numbers for 190.

    CantThinkAnyUserName

    DIY Journey. ✈️🇦🇺🦘 soooon
    Nominated Occupation > Agricultural Engineer


    Points Breakdown

    Age - 30 points | English - Superior 20 points| Qualifications (BS) - 15 points | Experience (8 yrs +) - 15 points | Single - 10 points = TOTAL POINTS > SC189 - 90 points; > SC190 - 95 points; SC491 - 105 points


    2023

    08.01.2023 - Started CDR Preparation
    08.25.2023 - Completed CDR/ CPD/ SS
    09.01.2023 - Start PTE Exam Preparation
    09.23.2023 - PTE Exam Proper
    09.23.2023 - PTE Result > L - 88 | R - 90 | S - 90 | W - 79 > Superior - 1 take only
    09.27.2023 - EA Skills Assessment Initial Document Upload (found some inconsistencies with date, had to postpone submission)
    09.28.2023 - EA Skills Assessment Submitted, RSEA + Fast Track
    10.18.2023 - EA Skills Assessment in Progress update
    11.08.2023 - EA Skills Assessment Outcome - POSITIVE with 6 yrs + RSEA
    11.08.2023 - Immediately Submitted EOI for SC 189 with 85 points
    11.09.2023 - Submitted EOI / ROI for SC190 with 90 points for NSW/ VIC/ SA


    HAPPY NEW YEAR!! 2024

    01.09.2024 - Submitted EOI for SC 491 for NSW with 100 points
    01.19.2024 - Edited All EOIs for SC 189/190/491 to reflect new position in work
    01.24.2024 - Withdrawn EOI 190 / ROI for SA, Resubmitted EOI 491 / ROI for SA
    07.25.2024 - Updated All EOIs for SC 189/190/491 to reflect promotion in work
    09.30.2024 - Booked NAATI Exam for extra +5 points (scheduled at 11.13.2024)
    10.08.2024 - INCREASE IN POINTS - 8 years working experience +5 points baby; EOI’s recalculated for SC189, SC190 - NSW/QLD, SC491 - VIC/ SA/ NSW/ QLD
    11.07.2024 - Invited to Apply - SC 189 ; Cancelled NAATI Exam.


    Received my invitation to apply exactly 365 days (leap year) after I submitted my EOI.


    11.09.2024 - LODGED - Visa Application for SC 189 🇦🇺
    11.09.2024 - Withdrawn all other EOIs (NSW/VIC/SA/QLD). EOI of SC189 is now LOCKED.
    11.18.2024 - Immigration Medical Exam at St. Lukes Extension Clinic BGC
    11.19.2024 - Attached Joint Affidavit of Two Disinterested Person for Birth Certificate Clerical Error re: Mother’s First Name
    11.19.2024 - Health Clearance Provided - No further actions required
    WAIT for the GOLDEN EMAIL 📧 BEGINS
    02.10.2025 - VISA GRANTED (no S56, direct grant) 🏆
    Granted after 3 months of waiting


    MOVE PREPARATION


    13.02.2025 - Job Hunt Begins ⛏️🌾
    17.02.2025 - Completed PDOS and acquired CFO Certificate
    24.04.2025 - Got a Job Offer in Regional NSW, Australia
    16.06.2025 - BIG MOVE ✈️


    ROAD TO CITIZENSHIP


    xx.xx.xxxx -

  • cp101030cp101030 singapore
    Posts: 105Member
    Joined: Oct 23, 2016

    Hi guys, if work from home po yung company and wala po clang office. as per COE and sa employment contract US address po gmit nla. Sa EOI po ba under "Employment Details" for that company yung country - pd po bng ilagay kng sang country po kayo current nkareside? Wala po kayang mggng problema about this? Thank you and advance Merry Christmas po! :)

  • katebaekatebae Philippines
    Posts: 2Member
    Joined: Nov 18, 2024

    @cp101030 said:
    Hi guys, may nainvite n po b recently s NSW? Any ICT jobs po? Thank you

    Hello! First time to comment here. Nainvite po ako subclass 190 last Dec. 3, Developer Programmer (100 pts). Nagsubmit ako ng nomination application nung Dec. 6 tapos waiting for approval pa hanggang ngayon.

    fmp_921MidnightPanda12mathilde9casssiekidfrompolomolokcp101030manifestingvisagrant
  • manifestingvisagrantmanifestingvisagrant Posts: 90Member
    Joined: Feb 27, 2024

    Good day po,

    Ask ko lang kung baka may nakaexperience po dito:

    I successfully lodge and paid our 190 visa [family of 3] last December 12, 2024 (Thursday), right after naman ng pagbabayad, nakareceive ako ng email from Immi, acknowledgement letter from them, then nakita ko naman sa status ng visa ko is "received". But upon checking my EOI, nakalagay pa rin sa status "INVITED" instead na LODGED.

    Baka po may naexperience, ano po ginawa niyo? Salamat po ng marami!

  • mathilde9mathilde9 NSW
    Posts: 1,094Member, Moderator
    Joined: Nov 15, 2021

    @manifestingvisagrant said:
    Good day po,

    Ask ko lang kung baka may nakaexperience po dito:

    I successfully lodge and paid our 190 visa [family of 3] last December 12, 2024 (Thursday), right after naman ng pagbabayad, nakareceive ako ng email from Immi, acknowledgement letter from them, then nakita ko naman sa status ng visa ko is "received". But upon checking my EOI, nakalagay pa rin sa status "INVITED" instead na LODGED.

    Baka po may naexperience, ano po ginawa niyo? Salamat po ng marami!

    Hindi yan real-time nagssync. Wait mga 1week max before mo makita na LODGED. Before that 'lodged' status magiging 'suspended' pa yata yan. Which is normal lang. Basta magiging lodged din yan.

    manifestingvisagrantCantThinkAnyUserNamefmp_921

    OCCUPATION : SOFTWARE ENGINEER (261313) ~~ DIY. Offshore. Direct Grant
    Total Points ~~ NSW SC190: 90pts
    Points Breakdown:
    Age:25 | English:20 | Employment:15 | Education:15 | Single:10
    Been to Australia a few times and I just wanted to settle there. "I belong here" ganon.
    ~~~~
    10 2021 - Research about AU migration; read a lot of related articles; consulted with agent for initial assessment. Decided to DIY.
    11 2021 - PTE (Proficient)
    11 2021 - Suitable ACS Skills Assessment received (8+ years suitable, 5weeks 4days TAT)
    ~~~~
    01 2022 - EOIs submitted (matumal and slight hiatus since na-busy sa ibang bagay)
    ~~~~
    09 2023 - PTE retake (Superior 90 overall)
    09 2023 - Updated EOIs to reflect +10pts on English Test
    11 2023 - ACS Assessment expired T_T (but already prepared for re-assessment a few weeks before)
    11 2023 - ACS deemed my skills unsuitable because of missing documents. Nilaban ko.
    12 2023 - Suitable ACS Skills reassessment (8+ years) after 1month of review and pangungulit (no fee incurred, fault nila)
    12 2023 - Some EOIs expired T_T
    12 2023 - New EOIs submitted (NSW, VIC, ACT, and 189)
    ~~~~
    02 2024 - Booked NAATI Exam (desperate to max out point for a chance of invite)
    02 2024 - Received NSW 190 pre-invite!! ✩₊˚ (tears of joy, TYL! ). Cancelled NAATI test at 75% refund.
    02 2024 - Final NSW ITA received after 1 business day ✩₊˚
    02 2024 - Visa Lodgment
    02 2024 - Medicals. Cleared after 1 business day @ SATA AMK
    02 2024 - Singapore Police Clearance. Completed/claimed after 6 business days
    04 2025 - ** ✩₊˚.⋆☾⋆⁺₊✧ ** Visa Granted! TYL ** ✩₊˚.⋆☾⋆⁺₊✧ **

  • manifestingvisagrantmanifestingvisagrant Posts: 90Member
    Joined: Feb 27, 2024

    @mathilde9 said:

    @manifestingvisagrant said:
    Good day po,

    Ask ko lang kung baka may nakaexperience po dito:

    I successfully lodge and paid our 190 visa [family of 3] last December 12, 2024 (Thursday), right after naman ng pagbabayad, nakareceive ako ng email from Immi, acknowledgement letter from them, then nakita ko naman sa status ng visa ko is "received". But upon checking my EOI, nakalagay pa rin sa status "INVITED" instead na LODGED.

    Baka po may naexperience, ano po ginawa niyo? Salamat po ng marami!

    Hindi yan real-time nagssync. Wait mga 1week max before mo makita na LODGED. Before that 'lodged' status magiging 'suspended' pa yata yan. Which is normal lang. Basta magiging lodged din yan.

    Thank you po! o:)

  • Cerberus13Cerberus13 Dublin Ireland
    Posts: 379Member
    Joined: Mar 23, 2020

    @manifestingvisagrant said:
    Good day po,

    Ask ko lang kung baka may nakaexperience po dito:

    I successfully lodge and paid our 190 visa [family of 3] last December 12, 2024 (Thursday), right after naman ng pagbabayad, nakareceive ako ng email from Immi, acknowledgement letter from them, then nakita ko naman sa status ng visa ko is "received". But upon checking my EOI, nakalagay pa rin sa status "INVITED" instead na LODGED.

    Baka po may naexperience, ano po ginawa niyo? Salamat po ng marami!

    @manifestingvisagrant said:
    Good day po,

    Ask ko lang kung baka may nakaexperience po dito:

    I successfully lodge and paid our 190 visa [family of 3] last December 12, 2024 (Thursday), right after naman ng pagbabayad, nakareceive ako ng email from Immi, acknowledgement letter from them, then nakita ko naman sa status ng visa ko is "received". But upon checking my EOI, nakalagay pa rin sa status "INVITED" instead na LODGED.

    Baka po may naexperience, ano po ginawa niyo? Salamat po ng marami!

    Never ko na na check ung SkillSelect after invitation, because by that time ung status mo is more updated in ImmiAccount. Sa ImmiAccount ka na mag chi check from this point.

    (unless may hinihintay ka pa na other invite)

    MidnightPanda12CantThinkAnyUserNamefmp_921manifestingvisagrant

    ANZSCO 312111 - Architectural Draftsperson
    Location at the time of application: Offshore (Tokyo Japan) / DIY

    2020-Mar : Vetassess submission - Priority processing
    2020-Apr : Vetassess positive assessment - 5+ years employment
    2020-Jun 25 : First take PTE-A Tokyo - Superior
    2020-Jun : SkillSelect EOI lodge - 190/491 : 90/100 points

    2020 : Covid happened...

    2020-Aug : Job Offer - Ireland, Critical Skills Employment Permit path
    2020-Oct : Ireland Work permit granted
    2020-Oct : EOI auto updated due to age score dedcution - 190/491 : 85/95
    2020-Nov 18 : Ireland Employment Visa application
    2020-Nov 25 : Ireland work visa approved
    2020-Dec 26 : Moved to Dublin from Tokyo

    2022-Jun : EOI expired. New EOI lodged with no change in score
    2022-Aug : VIC opened for offshore. Lodged ROI for VIC
    2022-Sep : NSW opened for offshore. Created new EOI for NSW only
    2022-Sep : Removed 491 in my EOI. Only considering 190 for now
    2022-Nov 10 : Irish Stamp 4 status approved
    2022-Nov 29 : Received pre-ITA from NSW. Yay!
    2022-Nov 30 : Received nomination from NSW
    2023-Jan 13 : Visa 190 lodged
    2023-Feb 21 : Medicals
    2023-Feb 29 : Medicals cleared
    2023-Mar 15 : Japan PCC uploaded. Officially waiting for grant : )
    2023-Nov 23 : NSW 190 granted!

  • MidnightPanda12MidnightPanda12 Philippines
    Posts: 287Member
    Joined: May 23, 2020

    @Cerberus13 said:

    @manifestingvisagrant said:
    Good day po,

    Ask ko lang kung baka may nakaexperience po dito:

    I successfully lodge and paid our 190 visa [family of 3] last December 12, 2024 (Thursday), right after naman ng pagbabayad, nakareceive ako ng email from Immi, acknowledgement letter from them, then nakita ko naman sa status ng visa ko is "received". But upon checking my EOI, nakalagay pa rin sa status "INVITED" instead na LODGED.

    Baka po may naexperience, ano po ginawa niyo? Salamat po ng marami!

    @manifestingvisagrant said:
    Good day po,

    Ask ko lang kung baka may nakaexperience po dito:

    I successfully lodge and paid our 190 visa [family of 3] last December 12, 2024 (Thursday), right after naman ng pagbabayad, nakareceive ako ng email from Immi, acknowledgement letter from them, then nakita ko naman sa status ng visa ko is "received". But upon checking my EOI, nakalagay pa rin sa status "INVITED" instead na LODGED.

    Baka po may naexperience, ano po ginawa niyo? Salamat po ng marami!

    Never ko na na check ung SkillSelect after invitation, because by that time ung status mo is more updated in ImmiAccount. Sa ImmiAccount ka na mag chi check from this point.

    (unless may hinihintay ka pa na other invite)

    Same, magsasawa ka na nga sa interface ng immiaccount and mapupuno email mo ng login notification. Hahahaha.

    CantThinkAnyUserNamefmp_921manifestingvisagrant

    DIY Journey. ✈️🇦🇺🦘 soooon
    Nominated Occupation > Agricultural Engineer


    Points Breakdown

    Age - 30 points | English - Superior 20 points| Qualifications (BS) - 15 points | Experience (8 yrs +) - 15 points | Single - 10 points = TOTAL POINTS > SC189 - 90 points; > SC190 - 95 points; SC491 - 105 points


    2023

    08.01.2023 - Started CDR Preparation
    08.25.2023 - Completed CDR/ CPD/ SS
    09.01.2023 - Start PTE Exam Preparation
    09.23.2023 - PTE Exam Proper
    09.23.2023 - PTE Result > L - 88 | R - 90 | S - 90 | W - 79 > Superior - 1 take only
    09.27.2023 - EA Skills Assessment Initial Document Upload (found some inconsistencies with date, had to postpone submission)
    09.28.2023 - EA Skills Assessment Submitted, RSEA + Fast Track
    10.18.2023 - EA Skills Assessment in Progress update
    11.08.2023 - EA Skills Assessment Outcome - POSITIVE with 6 yrs + RSEA
    11.08.2023 - Immediately Submitted EOI for SC 189 with 85 points
    11.09.2023 - Submitted EOI / ROI for SC190 with 90 points for NSW/ VIC/ SA


    HAPPY NEW YEAR!! 2024

    01.09.2024 - Submitted EOI for SC 491 for NSW with 100 points
    01.19.2024 - Edited All EOIs for SC 189/190/491 to reflect new position in work
    01.24.2024 - Withdrawn EOI 190 / ROI for SA, Resubmitted EOI 491 / ROI for SA
    07.25.2024 - Updated All EOIs for SC 189/190/491 to reflect promotion in work
    09.30.2024 - Booked NAATI Exam for extra +5 points (scheduled at 11.13.2024)
    10.08.2024 - INCREASE IN POINTS - 8 years working experience +5 points baby; EOI’s recalculated for SC189, SC190 - NSW/QLD, SC491 - VIC/ SA/ NSW/ QLD
    11.07.2024 - Invited to Apply - SC 189 ; Cancelled NAATI Exam.


    Received my invitation to apply exactly 365 days (leap year) after I submitted my EOI.


    11.09.2024 - LODGED - Visa Application for SC 189 🇦🇺
    11.09.2024 - Withdrawn all other EOIs (NSW/VIC/SA/QLD). EOI of SC189 is now LOCKED.
    11.18.2024 - Immigration Medical Exam at St. Lukes Extension Clinic BGC
    11.19.2024 - Attached Joint Affidavit of Two Disinterested Person for Birth Certificate Clerical Error re: Mother’s First Name
    11.19.2024 - Health Clearance Provided - No further actions required
    WAIT for the GOLDEN EMAIL 📧 BEGINS
    02.10.2025 - VISA GRANTED (no S56, direct grant) 🏆
    Granted after 3 months of waiting


    MOVE PREPARATION


    13.02.2025 - Job Hunt Begins ⛏️🌾
    17.02.2025 - Completed PDOS and acquired CFO Certificate
    24.04.2025 - Got a Job Offer in Regional NSW, Australia
    16.06.2025 - BIG MOVE ✈️


    ROAD TO CITIZENSHIP


    xx.xx.xxxx -

  • cp101030cp101030 singapore
    Posts: 105Member
    Joined: Oct 23, 2016

    Guys any offshore with 85 pts na nainvite from NSW this FY? My chance kaya? Points went down to this point ksi lately lng cia nkasuperior s PTE at the age of 40. For SA, my chance kaya ang ICT job with 95 pts? Thank you

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

jackmart2bruce22tzailyrammurilloJustin32Chuy92mikelachica777morganccemmancpparkerkhanwenggaygaynildaUme_HaiderMichierose85thelostStark01flintandstnesJanelinejosephjcarewiseplahgfc
Browse Members

Members Online (0) + Guest (116)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌