Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

489 visa to 887

12021232526

Comments

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017

    @Dr.S said:

    @chococrinkle said:
    There is a new concession released for 887 visa and it includes work requirement reduction of 9 months only for those affected by covid. With the new law eligible na kami, so we submitted our application yesterday 25th September. Praise God! 😊

    Saan po pwede makita ung details ng info na ito? Thanks

    Hello, pls see link below:

    https://immi.homeaffairs.gov.au/visas/getting-a-visa/visa-listing/skilled-regional-887#Eligibility

    https://www.legislation.gov.au/Details/F2020L01181/Explanatory Statement/Text

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • Dr.SDr.S Laguna
    Posts: 9Member
    Joined: Aug 01, 2018

    @chococrinkle said:

    @Dr.S said:

    @chococrinkle said:
    There is a new concession released for 887 visa and it includes work requirement reduction of 9 months only for those affected by covid. With the new law eligible na kami, so we submitted our application yesterday 25th September. Praise God! 😊

    Saan po pwede makita ung details ng info na ito? Thanks

    Hello, pls see link below:

    https://immi.homeaffairs.gov.au/visas/getting-a-visa/visa-listing/skilled-regional-887#Eligibility

    https://www.legislation.gov.au/Details/F2020L01181/Explanatory Statement/Text

    Thank you po sa info.

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011

    @lccnsrsnn said:
    @Hunter_08 PR ka na?

    yup natanggap ko na yung grant ko last oct 12.

    baiken

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • AussiepangarapAussiepangarap Posts: 28Member
    Joined: Aug 27, 2016

    Hello there! Nag big move po kami nung Nov8,2018 dito sa Adelaide and nag rent lang po kami ng room for 1 month - di po kasali name namin sa tenancy agreement nila. Ayos lang po ba na magpasa na since mag 2 years na kmi sa nov8,20. Magkaka issue kaya iyon? Thanks po

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011

    @Aussiepangarap said:
    Hello there! Nag big move po kami nung Nov8,2018 dito sa Adelaide and nag rent lang po kami ng room for 1 month - di po kasali name namin sa tenancy agreement nila. Ayos lang po ba na magpasa na since mag 2 years na kmi sa nov8,20. Magkaka issue kaya iyon? Thanks po

    you can submit your application for 887 on Nov 9, 2020. basta na fulfil nyo na yung 1yr work na at least 35hrs per week at proof for residence niyo for 2yrs.

    Enzeru08

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011

    @Aussiepangarap said:
    Hello there! Nag big move po kami nung Nov8,2018 dito sa Adelaide and nag rent lang po kami ng room for 1 month - di po kasali name namin sa tenancy agreement nila. Ayos lang po ba na magpasa na since mag 2 years na kmi sa nov8,20. Magkaka issue kaya iyon? Thanks po

    you can get a letter from the main tenant, indicating that you are renting under them.

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011

    @batman kamusta na? nasa Darwin ka pa din? kailan ka mag apply ng 887?

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011

    @Hunter_08 said:
    @batman kamusta na? nasa Darwin ka pa din? kailan ka mag apply ng 887?

    doing good mate! yes, plan to stay for good here in Darwin. Found a good job opportunity. Applying for PR on Feb 2021

    Hunter_08Enzeru08

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • iamveeiamvee SG
    Posts: 66Member
    Joined: Aug 15, 2017

    Hello batch mates, I lodged my 887 last 08 Oct, uploaded docs I could think of to present a complete application para iwas CO contact sana... question ko lang, do I have to upload yung recent rental/utility bills natanggap ko this month or enough na yung worth more than 2 years at the time of application?

  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011

    @iamvee said:
    Hello batch mates, I lodged my 887 last 08 Oct, uploaded docs I could think of to present a complete application para iwas CO contact sana... question ko lang, do I have to upload yung recent rental/utility bills natanggap ko this month or enough na yung worth more than 2 years at the time of application?

    enough na yung proof of 2 years stay.

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • Enzeru08Enzeru08 Hoabart, Tasmania
    Posts: 61Member
    Joined: Oct 23, 2017

    @Hunter_08 said:

    @Aussiepangarap said:
    Hello there! Nag big move po kami nung Nov8,2018 dito sa Adelaide and nag rent lang po kami ng room for 1 month - di po kasali name namin sa tenancy agreement nila. Ayos lang po ba na magpasa na since mag 2 years na kmi sa nov8,20. Magkaka issue kaya iyon? Thanks po

    you can submit your application for 887 on Nov 9, 2020. basta na fulfil nyo na yung 1yr work na at least 35hrs per week at proof for residence niyo for 2yrs.

    @dutchmilk said:

    @Enzeru08 said:
    Sa application po ba ng 887, ako ung main applicant then ung wife ko kelangan din ba kumuha uli ng COC from sg, NBI at ng baong english test?

    bumalik bah cya ng SG at pinas after kayo nag big move dito?
    kc kami di na lumabas ng AU at di na kumuha ng bagong NBI at SG CoC. then yung english test, kumuha lng kami ng CEMI (Certificate of English as Medium of Instructions) from our university. Though wala pa kaming grant ha but based sa mga kakilala ko with same situation as ours, na grant naman cla.

    @dutchmilk thank you sa info. hindi kme bumalik ng sg at pinas since ng BM kme d2. pero lumabas kme ng OZ last year to Auckland lng pero few days lng un. kelan k ngsubmit ng 887 mo? di bale next na yang sayo mggrant. blitaan mo kme.

  • Enzeru08Enzeru08 Hoabart, Tasmania
    Posts: 61Member
    Joined: Oct 23, 2017

    @Hunter_08 said:

    @lccnsrsnn said:
    @Hunter_08 PR ka na?

    yup natanggap ko na yung grant ko last oct 12.

    @Hunter_08 congrats pla s grant ng 887 mo....

  • YouOneYouOne Singapore
    Posts: 72Member
    Joined: May 02, 2016

    hello po! any idea po kung anong month na yung prinoprocess nila?

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011

    @Enzeru08 said:

    @Hunter_08 said:

    @lccnsrsnn said:
    @Hunter_08 PR ka na?

    yup natanggap ko na yung grant ko last oct 12.

    @Hunter_08 congrats pla s grant ng 887 mo....

    Thank you..

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011

    @YouOne said:
    hello po! any idea po kung anong month na yung prinoprocess nila?

    Currently Aug yung pina process nila.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • ireneskyirenesky Queensland
    Posts: 165Member
    Joined: Aug 29, 2017

    @fgs @batman at sa iba pa pong makakasagot

    I am on visa 489 po and I am about to lodge my 887 this coming August, I am a single mum and my only dependent which is my daughter had her initial entry last August 2019 and just stayed for 3 weeks, she was about to fly back last May 2020 but due to the current situation she wasn't able to come till now as visa 489 po is not allowed to travel to Australia, is there any impact po kaya on my 887 application given that she might not enter here during my visa lodgement? Or just in case naman po na she could enter AU before I lodge my Visa would it have an impact on us as she stayed less than a year?

    Thank you po in advance

    Engineering Technologist -ANZSCO 233914

    19.11.2016 - IELTS - competent
    01.07.2017 - Submitted fast track EA assessment.
    11.07.2017 - EA Asked for additional documents
    31.07.2017 - Positive MSA
    16.08.2017 - Submitted EOI to NSW 90 (60 pts)
    09.01.2018 - PTE- proficient
    11.01.2018 - Updated EOI 189 (65pts) /NSW190 (70pts)
    09.02.2018 -Submitted nomination application to VIC (70 pts)
    02.07.2018- Submitted EOI to QLD 489 (75 pts)
    04.07.2018- Received ITA from QLD
    01.09.2018 - Lodged Visa
    07.11.2018 - CO contact
    21.01.2019 - 2nd CO contact
    01.04.2019 - Granted "Thank you Lord"
    18.08.2019 - Big move
    11.11.2019 - Got a job
    09.09.2021 - Lodged visa 887
    21.12.2022 -CO contact
    09.01.2023 -Submitted requested documents
    waiting.........
    Patience is not simply the ability to wait - it's how we behave while we're waiting.... Joyce Meyer

  • fgsfgs Cooper Basin
    Posts: 1,161Member
    Joined: Nov 12, 2013

    @irenesky said:
    @fgs @batman at sa iba pa pong makakasagot

    I am on visa 489 po and I am about to lodge my 887 this coming August, I am a single mum and my only dependent which is my daughter had her initial entry last August 2019 and just stayed for 3 weeks, she was about to fly back last May 2020 but due to the current situation she wasn't able to come till now as visa 489 po is not allowed to travel to Australia, is there any impact po kaya on my 887 application given that she might not enter here during my visa lodgement? Or just in case naman po na she could enter AU before I lodge my Visa would it have an impact on us as she stayed less than a year?

    Thank you po in advance

    You must include your daughter on your 887application kasi wala syang right to apply on her own and i guess dapat onshore sya. But because of COVID, may concession for those stuck overseas and they can now apply while offshore. If it is still the current req, only the main applicant should have complied for the residency and work requirements. Goodluck!

    irenesky
  • archbunkiarchbunki singapore
    Posts: 271Member
    Joined: Jan 19, 2015

    medyu mahirap nga mam un situation nyu. pero minor naman ung anak nyu and i think include mo sya sa 489. un daughter wala naman sila 2 years stay dito pero kasama ko sila dito as subsequent entry ng 489 when i applied sa 887 granted naman po.
    i think considerate naman sila esp pag may bata, to ally your concern maybe you can write to immi po. Hopefully makasama mo na anak mo. πŸ™πŸ»

    I am on visa 489 po and I am about to lodge my 887 this coming August, I am a single mum and my only dependent which is my daughter had her initial entry last August 2019 and just stayed for 3 weeks, she was about to fly back last May 2020 but due to the current situation she wasn't able to come till now as visa 489 po is not allowed to travel to Australia, is there any impacte po kaya on my 887 application given that she might not enter here during my visa lodgement? Or just in case naman po na she could enter AU before I lodge my Visa would it have an impact on us as she stayed less than a year?

    Thank you po in advance

    @irenesky said:
    @fgs @batman at sa iba pa pong makakasagot

    I am on visa 489 po and I am about to lodge my 887 this coming August, I am a single mum and my only dependent which is my daughter had her initial entry last August 2019 and just stayed for 3 weeks, she was about to fly back last May 2020 but due to the current situation she wasn't able to come till now as visa 489 po is not allowed to travel to Australia, is there any impact po kaya on my 887 application given that she might not enter here during my visa lodgement? Or just in case naman po na she could enter AU before I lodge my Visa would it have an impact on us as she stayed less than a year?

    Thank you po in advance

    Nominated Skill: 312111
    Nov 2019 - Lodge 887

  • nnanni01nnanni01 Posts: 41Member
    Joined: Jun 20, 2017

    Hello good evening po.. tanong ko lang kasi offshore kme ng baby ko gawa ng covid hindi kme pa makabalik. Ngapply kme kay baby subsequent entrant 489 pending pa ngyon kasi sa pinas ako nanganak. Sa feb pwede na kme mgapply ng 887. Pwede po kaya kaht mei pending na 489 SE si baby e makaapply na dn kme ng visa 887? Thank you

  • fgsfgs Cooper Basin
    Posts: 1,161Member
    Joined: Nov 12, 2013

    @nnanni01 said:
    Hello good evening po.. tanong ko lang kasi offshore kme ng baby ko gawa ng covid hindi kme pa makabalik. Ngapply kme kay baby subsequent entrant 489 pending pa ngyon kasi sa pinas ako nanganak. Sa feb pwede na kme mgapply ng 887. Pwede po kaya kaht mei pending na 489 SE si baby e makaapply na dn kme ng visa 887? Thank you

    All 887 visa applicants should have held a 489 visa. Since di pa naaapproved application baby mo, you have to wait till the visa is approved and have done the initial entry.

    nnanni01
  • ireneskyirenesky Queensland
    Posts: 165Member
    Joined: Aug 29, 2017

    @irenesky said:
    @fgs @batman at sa iba pa pong makakasagot

    I am on visa 489 po and I am about to lodge my 887 this coming August, I am a single mum and my only dependent which is my daughter had her initial entry last August 2019 and just stayed for 3 weeks, she was about to fly back last May 2020 but due to the current situation she wasn't able to come till now as visa 489 po is not allowed to travel to Australia, is there any impact po kaya on my 887 application given that she might not enter here during my visa lodgement? Or just in case naman po na she could enter AU before I lodge my Visa would it have an impact on us as she stayed less than a year?

    Thank you po in advance

    @fgs said:

    @irenesky said:
    @fgs @batman at sa iba pa pong makakasagot

    I am on visa 489 po and I am about to lodge my 887 this coming August, I am a single mum and my only dependent which is my daughter had her initial entry last August 2019 and just stayed for 3 weeks, she was about to fly back last May 2020 but due to the current situation she wasn't able to come till now as visa 489 po is not allowed to travel to Australia, is there any impact po kaya on my 887 application given that she might not enter here during my visa lodgement? Or just in case naman po na she could enter AU before I lodge my Visa would it have an impact on us as she stayed less than a year?

    Thank you po in advance

    You must include your daughter on your 887application kasi wala syang right to apply on her own and i guess dapat onshore sya. But because of COVID, may concession for those stuck overseas and they can now apply while offshore. If it is still the current req, only the main applicant should have complied for the residency and work requirements. Goodluck!

    @fgs thank you so much po sa pagsagot I'll keep that in mine and hopefully maka etnter na lang sya before po ako mg lodge ng 887 sa August.

    Engineering Technologist -ANZSCO 233914

    19.11.2016 - IELTS - competent
    01.07.2017 - Submitted fast track EA assessment.
    11.07.2017 - EA Asked for additional documents
    31.07.2017 - Positive MSA
    16.08.2017 - Submitted EOI to NSW 90 (60 pts)
    09.01.2018 - PTE- proficient
    11.01.2018 - Updated EOI 189 (65pts) /NSW190 (70pts)
    09.02.2018 -Submitted nomination application to VIC (70 pts)
    02.07.2018- Submitted EOI to QLD 489 (75 pts)
    04.07.2018- Received ITA from QLD
    01.09.2018 - Lodged Visa
    07.11.2018 - CO contact
    21.01.2019 - 2nd CO contact
    01.04.2019 - Granted "Thank you Lord"
    18.08.2019 - Big move
    11.11.2019 - Got a job
    09.09.2021 - Lodged visa 887
    21.12.2022 -CO contact
    09.01.2023 -Submitted requested documents
    waiting.........
    Patience is not simply the ability to wait - it's how we behave while we're waiting.... Joyce Meyer

  • ireneskyirenesky Queensland
    Posts: 165Member
    Joined: Aug 29, 2017

    @archbunki said:
    medyu mahirap nga mam un situation nyu. pero minor naman ung anak nyu and i think include mo sya sa 489. un daughter wala naman sila 2 years stay dito pero kasama ko sila dito as subsequent entry ng 489 when i applied sa 887 granted naman po.
    i think considerate naman sila esp pag may bata, to ally your concern maybe you can write to immi po. Hopefully makasama mo na anak mo. πŸ™πŸ»

    I am on visa 489 po and I am about to lodge my 887 this coming August, I am a single mum and my only dependent which is my daughter had her initial entry last August 2019 and just stayed for 3 weeks, she was about to fly back last May 2020 but due to the current situation she wasn't able to come till now as visa 489 po is not allowed to travel to Australia, is there any impacte po kaya on my 887 application given that she might not enter here during my visa lodgement? Or just in case naman po na she could enter AU before I lodge my Visa would it have an impact on us as she stayed less than a year?

    Thank you po in advance

    @irenesky said:
    @fgs @batman at sa iba pa pong makakasagot

    I am on visa 489 po and I am about to lodge my 887 this coming August, I am a single mum and my only dependent which is my daughter had her initial entry last August 2019 and just stayed for 3 weeks, she was about to fly back last May 2020 but due to the current situation she wasn't able to come till now as visa 489 po is not allowed to travel to Australia, is there any impact po kaya on my 887 application given that she might not enter here during my visa lodgement? Or just in case naman po na she could enter AU before I lodge my Visa would it have an impact on us as she stayed less than a year?

    Thank you po in advance

    @archbunki thank you so much sa pagsagot, I will do that po I'll write to the immigration po and hopefully maging positive ang outcome, sana nga po makasama ko na din sya

    Engineering Technologist -ANZSCO 233914

    19.11.2016 - IELTS - competent
    01.07.2017 - Submitted fast track EA assessment.
    11.07.2017 - EA Asked for additional documents
    31.07.2017 - Positive MSA
    16.08.2017 - Submitted EOI to NSW 90 (60 pts)
    09.01.2018 - PTE- proficient
    11.01.2018 - Updated EOI 189 (65pts) /NSW190 (70pts)
    09.02.2018 -Submitted nomination application to VIC (70 pts)
    02.07.2018- Submitted EOI to QLD 489 (75 pts)
    04.07.2018- Received ITA from QLD
    01.09.2018 - Lodged Visa
    07.11.2018 - CO contact
    21.01.2019 - 2nd CO contact
    01.04.2019 - Granted "Thank you Lord"
    18.08.2019 - Big move
    11.11.2019 - Got a job
    09.09.2021 - Lodged visa 887
    21.12.2022 -CO contact
    09.01.2023 -Submitted requested documents
    waiting.........
    Patience is not simply the ability to wait - it's how we behave while we're waiting.... Joyce Meyer

  • nnanni01nnanni01 Posts: 41Member
    Joined: Jun 20, 2017

    @fgs said:

    @nnanni01 said:
    Hello good evening po.. tanong ko lang kasi offshore kme ng baby ko gawa ng covid hindi kme pa makabalik. Ngapply kme kay baby subsequent entrant 489 pending pa ngyon kasi sa pinas ako nanganak. Sa feb pwede na kme mgapply ng 887. Pwede po kaya kaht mei pending na 489 SE si baby e makaapply na dn kme ng visa 887? Thank you

    All 887 visa applicants should have held a 489 visa. Since di pa naaapproved application baby mo, you have to wait till the visa is approved and have done the initial entry.

    Noted. Thank you for the advice po😊

  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011
    edited February 2021

    We just lodged our 887 application. :) nag update lang.

    bbtot

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011

    @batman said:
    We just lodge our 887 application. :) nag update lang.

    congrats! hopefully bumilis ulit ang grants.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011

    @Hunter_08 said:

    @batman said:
    We just lodge our 887 application. :) nag update lang.

    congrats! hopefully bumilis ulit ang grants.

    sabi 20-26 months processing. pero ok lang di naman kami nag mamadali. hehe!

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • magueromaguero Adelaide
    Posts: 831Member
    Joined: Oct 24, 2016
  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011

    @maguero said:
    @batman Congrats!

    thanks, wala pa grant. hehe! Citizen kana @maguero ?

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

pwinkytikatikarikaweesralifeafter23cami0503brendamiijamesedwardjabbabsEAVjennifer_hope_ngoAljeanpengalreadyexistsmayajunis22elmer123DavidHexTeacher_ErinTerenceFagKJoanneDanielBizGeorgecix
Browse Members

Members Online (0) + Guest (93)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

πŸš€ We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌