Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

PTE ACADEMIC

1668669671673674755

Comments

  • stevensteven Philippines
    Posts: 273Member
    Joined: Feb 25, 2017

    READING

    Multiple choice, choose single answer -

    • I only spend 1.5 minutes each item
    • You can easily determine if the task is MCSA because of the round-shaped option
    button
    • Enhance your Speed-reading skills (understand the text while reading rapidly)
    • Basta MCSA, binabasa ko talaga ang text kasi maikli lang naman at less complicated
    compared sa MCMA.
    • Ito yung steps na ginamit ko:
    (1) Read and focus on the key words in the prompt
    (2) Read the text for 35 secs (usually short paragraph(s) lang ang MCSA). While reading and
    understanding the text, bring back the information from the question/prompt into your
    mind, para mas madaling mahanap yung keywords na related dun sa prompt.
    (3) Binabasa ko ulit yung text for another 35 secs kasi minsan 50% lang yung na iintindihan
    ko sa first attempt.
    (4) I used to spend 20 secs of the 1.5-minute duration to choose an answer.

    • Note: These steps would really require a lot of practice.
    • Three sources na ginamit ko para maka practice talaga:
    -una kong ginamit ang https://ptetutorials.com/sample-questions/reading-multiple-
    choice-choose-single-answer
    -after ptetutorials, nag practice ako dito sa https://ptestudy.com/
    -Lastly, https://www.apeuni.com/practice/reading?model=r_mcs&num=1&menu=all

    Multiple choice, choose multiple answers -

    • I only spend 2 minutes each item
    • You can easily determine if the task is MCMA because of the square-shaped option
    button
    • Hindi speed-reading technique ang ginamit ko dito kasi masyadong mahaba yung
    texts compared to MCSA. Na try kong mag apply ng speed-reading, kaso mas kaunti
    lang yung naiintindihan ko dahil talagang mabilisan yung pag babasa within 2 mins.
    • Ito yung steps na ginamit ko:
    (1) Understand the question/prompt and collect key words
    (2) Hanapin dun sa text yung keyword(s) from the prompt, sometimes yung synonyms ng
    word ang nasa text.
    (3) Try to locate all possible locations ng keywords dun sa texts para madaling balikan
    afterwards. Kasi you need more than 1 answer.
    (4) Read that certain sentence/phrases before and after the keyword. Umiikot lang dito yung
    answers talaga. Then, look at the choices kung may related idea ba na makikita based sa
    binasa mong sentence.
    (5) With this scheme, di mo kelangan basahin yung buong paragraphs. Just read one
    sentence before the keyword and once sentence after the keyword.

    • Itong strategy na’to ay same lang din sa strategy ni Moni PTE Magic


    • Three sources na ginamit ko para maka practice talaga:

    Re-order paragraphs -

    Rule:
    Obj of 1st sentence becomes Subj of the 2nd sentence
    Obj of 2nd sentence becomes Subj of the 3rd sentence
    Obj of 3rd sentence becomes Subj of the 4th sentence

    Some findings:
    • Take note of the sequence of events. Based dun sa experiences ko during practice
    session, kadalasan nauuna yung past events followed by current events.
    Ex:
    (1) So in the agrarian era, if you need to destroy ………
    (2) But in the industrial era, destroying the …..
    (3) Now in the information era, destroying the …..

    • Take note of the paragraphs containing “I”, “I have”. Paragraphs containing personal
    pronoun “I” are closely related to each other.
    Kadalasan magkakasunod yung sequence ng paragraphs with “I”.

    • Active sentences should come first before Passive sentences
    • Paragraph with article “A” should come first before paragraph containing “The”

    I had tried studying several sources before. Pero, ito yung complete package para sa akin:

    • E2 PTE Academic

    • E2 PTE Academic

    • Five Finger Strategy

    • Three sources na ginamit ko para maka practice talaga sa Re-order
    paragraphs

    https://ptetutorials.com/sample-questions/reading-re-order-paragraphs
    https://www.apeuni.com/
    https://ptestudy.com/

    Reading: Fill in the blanks -
    (I only spend 2 minutes for this task)

    Reading & writing: Fill in the blanks - (I only spend 2.5 minutes for this task)

    • Practice lang talaga ginawa ko dito
    • Ito yung challenge---- if you can practice answering at least 80% of the total number
    of questions from each of the resources below, you can certainly bolster your skills
    para dito sa Fill in the blanks Tasks.

    https://ptetutorials.com/sample-questions/reading-and-writing-fill-in-the-blanks
    https://ptetutorials.com/sample-questions/reading-fill-in-the-blanks
    https://www.apeuni.com/
    https://ptestudy.com/

    caspersushi24

    ANZSCO 233411 | Electronics Engineer |
    Age = 30 | Edu = 15 | Exp = 15 | PTE = 20 | Partner's English = 5 | NAATI = 5 | Visa 189/190/491=90/95/105 points

    Jeremiah 29:11
    For I know the plans I have for you,” declares the Lord, “plans to prosper you and not to harm you, plans to give you hope and a future.

    NAATI-CCL Tips:
    https://pinoyau.info/discussion/11185/naati-ccl-exam-additional-5-points-for-189-190-visa#latest

    PTE Strategies/Tips:
    https://pinoyau.info/discussion/4233/pte-academic/p585
    https://pinoyau.info/discussion/4233/pte-academic/p587

  • stevensteven Philippines
    Posts: 273Member
    Joined: Feb 25, 2017

    *** Listening ***

    Summarize spoken text -

    • Instead of listening to music for several months, ito yung pina pakinggan ko :

    Mindvalley sa Youtube,  2 videos during lunch break
    TED Talk at TEDx sa Youtube  2 videos before bedtime
    https://www.bbc.co.uk/programmes/p02nq0gn/episodes/downloads  2 episodes while

    working

    • Fast note-taking yung pina practice ko dito. While listening to podcasts, nag susulat
    ako.
    • Use a lot of abbreviations when taking notes, para mabilis…or make your own
    abbreviations.
    • Ito yung way ko, for example:
    Audio: “The worldwide population of wild giant pandas increased by 268 over the
    last decade according to a new survey conducted by the government of
    China.”

    My writing: “wrldwide populatn wild giant pandas incrsd 268 last decade survey by
    govt China…..”

    • Practice taking notes while listening & understanding the audio
    • Ito yung templates ko:

    The speaker was mainly discussing ________.
    Firtsly, he/she mentioned that_________.
    He/she then stated that ______.
    In addition, he/she discussed/expounded that ______.
    Moreover, he/she described/elucidated the fact that ______.
    Lastly, he/she suggested/highlighted that ______.

    Multiple choice, choose multiple answers -

    • I spend only 2 minutes for this task
    • Spend the preparation time (5 – 7 secs) to read and understand the question/prompt
    • If the options have long sentences, grasp your erasable booklet and prepare for note-
    taking
    • If maikli lang yung sentences (options), just listen carefully and glance at the options
    while listening, para may hint kung anong option ang candidate for elimination.

    Fill in the blanks -

    • I spend only 2 minutes for this task
    • Spend the preparation time (5 – 7 secs) to examine the entire boxes and take note
    kung gaano ka dikit yung mga “blanks”, sometimes blanks/boxes are only separated
    by 3 words. So, be prepared by examining ahead of time which part ng paragraph na
    may ganito para ma anticipate mo.
    • Di baling mali2x yung spelling when typing your answers, balikan mo nalang afterwards.
    Ang importante di ka mawawala sa audio.

    Highlight correct summary -

    • For me, this is an effective method:

    Multiple choice, choose single answer -

    • I spend only 1 minute for this task
    • Same strategies with MCMA (listening)

    Select missing word -

    • Yung ginawa ko, talagang pinakinggan ko yung entire audio to get the main idea. While
    listening,… tinitingnan ko yung progress bar para ma anticipate yung pag hinto ng
    recording(with beep)

    • Malaking tulong kung makukuha mo yung main idea kasi sometimes kung babasahin mo
    yung options, halos lahat ay correct answers. So, understanding the main idea is your
    paramount guide.

    Highlight incorrect words -

    • Firstly, clear your desk…especially dun sa area ng mouse.
    • Yung sa akin, mag lift lang ako ng mouse if may new line na, pero kung nasa isang line
    palang yung pinapakinggan ko, I simply slide the mouse para hindi ako mawala dun sa
    recording vs. actual words na sinusundan.
    • Pag may obstacles when sliding your mouse, it would really affect your focus.
    • Ang ginawa ko dito, yung mouse cursor ko naka sunod dun sa mentioned words at yung
    mata ko nag babasa ng advance dun sa succeeding words.

    Write from dictation -

    • Ito yung approach ko:
    1) Nakatingin ako dun sa time status (Beginning in 3-2-1 seconds) before mag start yung audio
    2) Ginamit ko yung first 2 seconds to clear my mind and focus
    3) Sa remaining 1 sec, ito yung anticipation mood ko, gusto kong ma feel talaga na may audio akong ina-abangan. Kasi when I am anticipating for something, mas alert yung mind and ears ko. Parang may feeling of eagerness kung ano kaya ang lalabas na audio.

    • While listening, nag keyboard typing na agad ako sa mga words na napapakinggan ko,
    unlike dun sa repeat sentence.
    • Ito yung effective sa akin, kasi makukuha mo talaga yung mga keywords esp. kung
    mahaba yung sentences. Okay lang na may makakalimutan na helping verbs, articles, or
    prepositions, unahin mo munang e focus ang pag sulat ng keywords… saka mo nalang
    ayusin yung grammar afterwards.
    • Ito yung way ko para mabilis yung pag type ng words:

    For example: There are people who believe that ------> Dr r pple hu blv dat ...

    Dito ako nag practice for listening taks:
    https://ptetutorials.com/sample-questions/
    https://www.apeuni.com/
    https://ptestudy.com/

    Rej1019caspersushi24

    ANZSCO 233411 | Electronics Engineer |
    Age = 30 | Edu = 15 | Exp = 15 | PTE = 20 | Partner's English = 5 | NAATI = 5 | Visa 189/190/491=90/95/105 points

    Jeremiah 29:11
    For I know the plans I have for you,” declares the Lord, “plans to prosper you and not to harm you, plans to give you hope and a future.

    NAATI-CCL Tips:
    https://pinoyau.info/discussion/11185/naati-ccl-exam-additional-5-points-for-189-190-visa#latest

    PTE Strategies/Tips:
    https://pinoyau.info/discussion/4233/pte-academic/p585
    https://pinoyau.info/discussion/4233/pte-academic/p587

  • stevensteven Philippines
    Posts: 273Member
    Joined: Feb 25, 2017

    @Ed510 said:

    @steven said:
    @iaiaia NOTE: Yung "Thus" & "Hence" sa Body1 & Body 2 ay di ko na nagamit sa actual exam ko kasi parang sa tingin ko marami na akong nasulat. Pero mataas pa rin naman yung scores sa awa ng Panginoon.

    Hello po @steven
    Ano po ba tong template na mention dito sa chat? Pwede mo ma-share po sa akin?

    ==============================

    Hello @Ed510 ..nasa taas po ... I think yung essay template po yung tinatanong ni @iaiaia ..

    Ed510iaiaia

    ANZSCO 233411 | Electronics Engineer |
    Age = 30 | Edu = 15 | Exp = 15 | PTE = 20 | Partner's English = 5 | NAATI = 5 | Visa 189/190/491=90/95/105 points

    Jeremiah 29:11
    For I know the plans I have for you,” declares the Lord, “plans to prosper you and not to harm you, plans to give you hope and a future.

    NAATI-CCL Tips:
    https://pinoyau.info/discussion/11185/naati-ccl-exam-additional-5-points-for-189-190-visa#latest

    PTE Strategies/Tips:
    https://pinoyau.info/discussion/4233/pte-academic/p585
    https://pinoyau.info/discussion/4233/pte-academic/p587

  • Ed510Ed510 Quezon City
    Posts: 64Member
    Joined: May 17, 2015

    @steven said:

    @Ed510 said:

    @steven said:
    @iaiaia NOTE: Yung "Thus" & "Hence" sa Body1 & Body 2 ay di ko na nagamit sa actual exam ko kasi parang sa tingin ko marami na akong nasulat. Pero mataas pa rin naman yung scores sa awa ng Panginoon.

    Hello po @steven
    Ano po ba tong template na mention dito sa chat? Pwede mo ma-share po sa akin?

    ==============================

    Hello @Ed510 ..nasa taas po ... I think yung essay template po yung tinatanong ni @iaiaia ..

    Salamat po ng marami.

    ANZSCO 233411 (Electronics Engineer)
    Age:25, English Test:10, Qualification:15, Experience:15, Partner English:0, FS:0 |total: 65
    Visa 190: 70 points, Visa 491: 80 points

    00-Sep-12 - Applied for Australian Student Visa denied.
    00-Apr-15 - IELTS (L6.5, R6.5, W6, S7) overall 6.5
    00-Jun -15 - NZQA level 6, wife's is level 5. Cannot proceed to New Zealand migration.
    15-Jul -19 - signed contract with an agency for Australia GSM
    10-Sep-19 - 1st PTE Result ( L65, R58, S70, W77), disappointed with points
    19-Nov-20 - Submitted EA Assessment
    11-Feb-20 - 2nd PTE Result ( L78, R71, S90, W74)
    19-Mar-20 - EA Positive Assessment : Thank you Lord!
    03-Apr -20 - Submit EOI (Visa 190/491: 70/80 pts)
    01-Jun -20 - Partner is taking the IELTS Review
    **-***-20 - Partner English Test
    **-***-20 - Australian Immigration closed for offshore application.

    19-Sept-20-Apply for Australian Student Visa [Approved]
    02-Nov-20 - CoE from the College
    19-Dec-20 - Lodge Student Visa application
    14-Jan- 21 - Medical Examination
    17-Feb-21 - Health Undertaking
    24-Feb-21 - Student Visa Approved
    ---------------- To God be the Glory
    **-***-21- Waiting for Australian boarders to open

  • nashmacoy101nashmacoy101 Makati City
    Posts: 248Member
    Joined: Jul 13, 2017

    @steven said:

    @nashmacoy101 said:

    Thank you po sa lahat ng tips dito. I used @steven template for essays and sonny english for summaries and DI. Ung exam ko po kanina lang 8AM.

    ===========================
    @nashmacoy101 Congratulations ..ang galing.... taas ng scores mo :-) I'm glad na nakatulong yung ginawa kong template :-) All the best ! God Bless sa next steps .

    Thank you mga sir @steven @zekemadr! Kitakits sa Oz though madami pa akong hahabulin. @kkoala madam may NAATI pa plang pagbubusyhan na naman!

    ANZSCO 233211 | Civil Engineer
    07.09.2022 VISA GRANT (SC 190 NSW - 95PTS)
    09.08.2022 Qatar PCC
    18.06.2022 Medicals
    10.06.2022 Lodge Visa
    19.05.2022 Received final ITA from Skillselect
    18.05.2022 Received ITA from NSW and applied the same day
    16.05.2022 Created 3rd EOI
    27.04.2022 Received ITA from NSW (nasa junk folder kaya diko nakita, ayun expired link!)
    12.2021 Created 2nd EOI
    09.2020 Created 1st EOI pero na'lock kasi nakalimutan ko password at ung 3 questions KEK
    12.09.2020 PTE-A Wife (Proficient)
    07.09.2020 PTE-A L83 R90 S90 W90
    16.07.2020 Duplicate letter wife
    06.07.2020 RSEA outcome
    02.03.2020 PTE-A L75 R78 S85 W76
    01.2020 - back on track sa AU dream (sana magtuloy-tuloy na!)
    12.2017 - 12.2019: 2 years hiatus
    11.2017 EA outcome received
    08.2017 EA outcome letter wife

  • kkoalakkoala Posts: 62Member
    Joined: May 03, 2020

    @nashmacoy101 said:

    @kkoala said:

    Thank you po for all the tips in this thread. 😊 Took my exam this 8am din po sa Trident.

    I'm fairly sure may mga mali ako sa Listening part, and may konting stutter sa DI and RL. Kaya nagulat po ako 90 pa din.

    pede na ulit magNetflix madam!

    Uninstall na po ng APEuni 😅 most used app for the past 3 months.> @nashmacoy101 said:

    @steven said:

    @nashmacoy101 said:

    Thank you po sa lahat ng tips dito. I used @steven template for essays and sonny english for summaries and DI. Ung exam ko po kanina lang 8AM.

    ===========================
    @nashmacoy101 Congratulations ..ang galing.... taas ng scores mo :-) I'm glad na nakatulong yung ginawa kong template :-) All the best ! God Bless sa next steps .

    Thank you mga sir @steven @zekemadr! Kitakits sa Oz though madami pa akong hahabulin. @kkoala madam may NAATI pa plang pagbubusyhan na naman!

    Opo cino-consider ko din yan. Pero baka wait ko muna ang new SOL (if meron sa oct) para sure nandun pa rin po ang jobcode ko. 😅

    312111 | Architectural Draftsperson

    2020 Jul 14 - Submitted application to VETASSESS
    2020 Sep 07 - PTE Exam (Superior)
    2020 Sep 09 - Received positive outcome letter from VETASSESS
    2020 Sep 16 - Lodged EOI (sc491 - 95pts / sc190 - 85 pts)

    long wait during pandemic

    2022 May 12 - Pre-invite from NSW for sc491
    2022 May 19 - Submitted nomination application to NSW RDA Far South Coast
    2022 Jun 27 - ITA received, RDA nomination approved
    2022 Aug 21 - Lodged visa sc491
    2022 Aug 25 - Biometrics
    2022 Sep 10 - Medical
    2023 Feb 09 - Direct grant, no CO Contact

    2023 *** ** - Big move!

  • _sebodemacho_sebodemacho Melbourne, VIC
    Posts: 1,045Member, Moderator
    Joined: Sep 13, 2019

    @kkoala said:

    @nashmacoy101 said:

    @kkoala said:

    Thank you po for all the tips in this thread. 😊 Took my exam this 8am din po sa Trident.

    I'm fairly sure may mga mali ako sa Listening part, and may konting stutter sa DI and RL. Kaya nagulat po ako 90 pa din.

    pede na ulit magNetflix madam!

    Uninstall na po ng APEuni 😅 most used app for the past 3 months.> @nashmacoy101 said:

    @steven said:

    @nashmacoy101 said:

    Thank you po sa lahat ng tips dito. I used @steven template for essays and sonny english for summaries and DI. Ung exam ko po kanina lang 8AM.

    ===========================
    @nashmacoy101 Congratulations ..ang galing.... taas ng scores mo :-) I'm glad na nakatulong yung ginawa kong template :-) All the best ! God Bless sa next steps .

    Thank you mga sir @steven @zekemadr! Kitakits sa Oz though madami pa akong hahabulin. @kkoala madam may NAATI pa plang pagbubusyhan na naman!

    Opo cino-consider ko din yan. Pero baka wait ko muna ang new SOL (if meron sa oct) para sure nandun pa rin po ang jobcode ko. 😅

    congrats!! ano job code mo @kkoala ?

    DIY all the way. Avoid preachy, know-it-all, and unscrupulous agents AT ALL COSTS!


    "We must look for ways to be an active force in our own lives. We must take charge of our own destinies, design a life of substance and truly begin to live our dreams." - Les Brown


    261312 (Developer Programmer) - Main | 261111 (ICT Business Analyst) - Wife

    189 (95), 190 (100)


    2023

    14 Nov | BIG MOVE
    01 Nov | HIRED | First day of work. Remote working arrangement from SG
    --- Trying my luck at job hunting while in Singapore and BM planning on the side ---
    19 Apr | Direct Visa Grant | What a journey... JUST GRATEFUL!

    2022 - Pandemic Eases Off

    17 Nov | Medical Test Clearance
    15 Nov | Medical Test
    03 Nov | EOI #4, #6 | 189 Withdrawn, 190 NSW Withdrawn
    03 Nov | Visa Application | 190 VIC --- THE REAL WAITING GAME BEGINS!!!
    31 Oct | ITA | 190 VIC | never thought this day would come!!! T.T good decision to defer NSW nomination.
    27 Oct | Pre-ITA | 190 NSW --- sabi nila, when it rains, it pours!!!
    26 Oct | Nomination Application | 190 VIC
    26 Oct | Pre-ITA | 190 VIC --- one step closer, sa wakas, PADAYON!!!
    21 Oct | EOI #4, #5 + ROI, #6 DoE | 189, 190 VIC, 190 NSW
    21 Oct | ACS Assessment (Wife) Renewal - Suitable
    xx Mar| EOI#1, #2, #3 | 189 Expired, 190 NSW Expired, 190 VIC Expired

    2021 - Pandemic Still

    25 Sep | ACS Assessment (Main) Renewal - Suitable
    01 Feb | EOI#4 DoE | 189

    2020 - Pandemic

    19 Aug | EOI#1, #2, #3 DoE | 189, 190 NSW, 190 VIC
    30 Jul | NAATI CCL Online Test | Result: Passed
    09 Mar | PTE (Wife) | Results: L90 R80 S90 W82 (Superior)
    19 Feb | PTE (Main) | Results: L90 R83 S90 W82 (Superior)
    12 Feb | ACS Assessment (Wife) - Suitable | Expired

    2019

    24 Oct | ACS Assessment (Main) - Suitable | Expired

    2018

    --- Tons of research, document collection and other necessary preparations ---
    01 Sep | The Beginning | Had the chance to visit Oz, and immediately fell in love with it!

  • kkoalakkoala Posts: 62Member
    Joined: May 03, 2020

    @_sebodemacho said:

    @kkoala said:

    @nashmacoy101 said:
    Thank you mga sir @steven @zekemadr! Kitakits sa Oz though madami pa akong hahabulin. @kkoala madam may NAATI pa plang pagbubusyhan na naman!

    Opo cino-consider ko din yan. Pero baka wait ko muna ang new SOL (if meron sa oct) para sure nandun pa rin po ang jobcode ko. 😅

    congrats!! ano job code mo @kkoala ?

    312111 Archi Draftsperson po :)

    _sebodemacho

    312111 | Architectural Draftsperson

    2020 Jul 14 - Submitted application to VETASSESS
    2020 Sep 07 - PTE Exam (Superior)
    2020 Sep 09 - Received positive outcome letter from VETASSESS
    2020 Sep 16 - Lodged EOI (sc491 - 95pts / sc190 - 85 pts)

    long wait during pandemic

    2022 May 12 - Pre-invite from NSW for sc491
    2022 May 19 - Submitted nomination application to NSW RDA Far South Coast
    2022 Jun 27 - ITA received, RDA nomination approved
    2022 Aug 21 - Lodged visa sc491
    2022 Aug 25 - Biometrics
    2022 Sep 10 - Medical
    2023 Feb 09 - Direct grant, no CO Contact

    2023 *** ** - Big move!

  • kkoalakkoala Posts: 62Member
    Joined: May 03, 2020
    _sebodemachorose85xiaoxuenashmacoy101HeprexbaikeniaiaiaSupersaiyan

    312111 | Architectural Draftsperson

    2020 Jul 14 - Submitted application to VETASSESS
    2020 Sep 07 - PTE Exam (Superior)
    2020 Sep 09 - Received positive outcome letter from VETASSESS
    2020 Sep 16 - Lodged EOI (sc491 - 95pts / sc190 - 85 pts)

    long wait during pandemic

    2022 May 12 - Pre-invite from NSW for sc491
    2022 May 19 - Submitted nomination application to NSW RDA Far South Coast
    2022 Jun 27 - ITA received, RDA nomination approved
    2022 Aug 21 - Lodged visa sc491
    2022 Aug 25 - Biometrics
    2022 Sep 10 - Medical
    2023 Feb 09 - Direct grant, no CO Contact

    2023 *** ** - Big move!

  • rose85rose85 singapore
    Posts: 6Member
    Joined: Jan 31, 2018

    @kkoala said:

    @_sebodemacho said:

    @kkoala said:

    @nashmacoy101 said:
    Thank you mga sir @steven @zekemadr! Kitakits sa Oz though madami pa akong hahabulin. @kkoala madam may NAATI pa plang pagbubusyhan na naman!

    Opo cino-consider ko din yan. Pero baka wait ko muna ang new SOL (if meron sa oct) para sure nandun pa rin po ang jobcode ko. 😅

    congrats!! ano job code mo @kkoala ?

    312111 Archi Draftsperson po :)

    same po tayo @kkoala 312111.. congrats sayo

  • kkoalakkoala Posts: 62Member
    Joined: May 03, 2020

    @rose85 said:

    @kkoala said:

    @_sebodemacho said:

    @kkoala said:

    @nashmacoy101 said:
    Thank you mga sir @steven @zekemadr! Kitakits sa Oz though madami pa akong hahabulin. @kkoala madam may NAATI pa plang pagbubusyhan na naman!

    Opo cino-consider ko din yan. Pero baka wait ko muna ang new SOL (if meron sa oct) para sure nandun pa rin po ang jobcode ko. 😅

    congrats!! ano job code mo @kkoala ?

    312111 Archi Draftsperson po :)

    same po tayo @kkoala 312111.. congrats sayo

    Thank you po. :) Good luck po sa atin.

    rose85

    312111 | Architectural Draftsperson

    2020 Jul 14 - Submitted application to VETASSESS
    2020 Sep 07 - PTE Exam (Superior)
    2020 Sep 09 - Received positive outcome letter from VETASSESS
    2020 Sep 16 - Lodged EOI (sc491 - 95pts / sc190 - 85 pts)

    long wait during pandemic

    2022 May 12 - Pre-invite from NSW for sc491
    2022 May 19 - Submitted nomination application to NSW RDA Far South Coast
    2022 Jun 27 - ITA received, RDA nomination approved
    2022 Aug 21 - Lodged visa sc491
    2022 Aug 25 - Biometrics
    2022 Sep 10 - Medical
    2023 Feb 09 - Direct grant, no CO Contact

    2023 *** ** - Big move!

  • bartowskibartowski Posts: 116Member
    Joined: Nov 26, 2018

    Hello po,

    Mamssirs, sino po naka-pag exam sa Trident recently? Ok lang po pa-share ng experiences nyo? Like kung naka-mask po ba kayo habang nageexam tapos kung ilan po kayo sa exam room, etc. TIA

    261312 - Developer Programmer | Age: 25| English Proficiency: 20 | Education: 15 |Work Experience: 15 | Spouse English Proficiency: 5 | Total 80
    Timeline:
    2018-Dec : Started Inquiring to Migration Agent
    2019-Jan : Signed contract with Migration Agent
    2019-Jan : Started collating documents for ACS
    2019-Mar : Lodged ACS assessment
    2019-Apr : Took First PTE Exam - (Not enough points)
    2019-May : Received ACS Assessment
    2019-Aug : Took 2nd PTE Exam - L -70 R-82 S-79 W-74
    2019-Sep : Lodged NSW EOI visa 190 and submitted Canberra Matrix
    2020-Apr : Scheduled PTE but due to pandemic I had to move it to 2020-November
    2020-Nov : Took 3rd PTE Exam - L -90 R-71 S-90 W-78
    2020-Dec : My wife took her PTE Exam(competent level)
    2021-Jan: Started collating Docs( For Renewal of ACS Assessment)
    2021-Nov: Took 4th PTE Exam (L-90 R-85 S-90 W-75)
    2022-Apr: Took 5th PTE Exam(L-89 R-82 S-90 W-76)
    2022-June: Lodged ACS Assessment( Developer Programmer)
    2022-June: Scheduled for 6th PTE Exam
    2022-June/July: Received PTE Exam Result(Superior) - L -83 R- 80 S -90 W-84
    2022-August: Received ACS Assessment( Positive Result but low points)
    2022-August: Lodged EOIs(491 - 85-90pts/ 190(80pts)/ 189 (75pts)
    2022-September: Submitted missing docs to ACS for Review
    2022-October: Received Updated ACS Assessment(with Higher points)
    2022-October: Updated EOIs(491 - 90-95pts/ 190 - 85pts / 189 - 80pts)
    2023-Jan.5 : Received Pre-Invite from Victoria
    2023-Jan.11 : Received ITA from Victoria
    2023-Feb-02 : VISA 190 Lodged

    "Anything is POSSIBLE!!!" - Kevin Garnett, 2008 NBA Finals

  • kkoalakkoala Posts: 62Member
    Joined: May 03, 2020

    @bartowski said:
    Hello po,

    Mamssirs, sino po naka-pag exam sa Trident recently? Ok lang po pa-share ng experiences nyo? Like kung naka-mask po ba kayo habang nageexam tapos kung ilan po kayo sa exam room, etc. TIA

    Hello! I took the exam last Sep. 7 sa Trident. Required ang face mask all throughout the exam. 8am yung sched ko and around 9-10 people kami, pero 2 separate rooms. Dulong cubicle ako and nasa 2 people lang naririnig ko during speaking part. Anticipate nalang po na maingay talaga sa exam room. By 3:30pm, may result na po kami. :)

    312111 | Architectural Draftsperson

    2020 Jul 14 - Submitted application to VETASSESS
    2020 Sep 07 - PTE Exam (Superior)
    2020 Sep 09 - Received positive outcome letter from VETASSESS
    2020 Sep 16 - Lodged EOI (sc491 - 95pts / sc190 - 85 pts)

    long wait during pandemic

    2022 May 12 - Pre-invite from NSW for sc491
    2022 May 19 - Submitted nomination application to NSW RDA Far South Coast
    2022 Jun 27 - ITA received, RDA nomination approved
    2022 Aug 21 - Lodged visa sc491
    2022 Aug 25 - Biometrics
    2022 Sep 10 - Medical
    2023 Feb 09 - Direct grant, no CO Contact

    2023 *** ** - Big move!

  • AAelaineAAelaine Posts: 12Member
    Joined: Dec 22, 2019

    hi @kkoala thank you sa paghanap ng mga useful tips na ito hehe .. ask lang ako ng help 65 po need ko na score to each item. di po ba ito mahirap iachieve ?

  • kkoalakkoala Posts: 62Member
    Joined: May 03, 2020

    @AAelaine said:
    hi @kkoala thank you sa paghanap ng mga useful tips na ito hehe .. ask lang ako ng help 65 po need ko na score to each item. di po ba ito mahirap iachieve ?

    Kayang kaya po yan. Consistent practice lang po talaga and familiarize yourself sa test format. :) May free mock test din sa 79score.com para ma-try mo po yung flow ng exam.

    iaiaia

    312111 | Architectural Draftsperson

    2020 Jul 14 - Submitted application to VETASSESS
    2020 Sep 07 - PTE Exam (Superior)
    2020 Sep 09 - Received positive outcome letter from VETASSESS
    2020 Sep 16 - Lodged EOI (sc491 - 95pts / sc190 - 85 pts)

    long wait during pandemic

    2022 May 12 - Pre-invite from NSW for sc491
    2022 May 19 - Submitted nomination application to NSW RDA Far South Coast
    2022 Jun 27 - ITA received, RDA nomination approved
    2022 Aug 21 - Lodged visa sc491
    2022 Aug 25 - Biometrics
    2022 Sep 10 - Medical
    2023 Feb 09 - Direct grant, no CO Contact

    2023 *** ** - Big move!

  • AAelaineAAelaine Posts: 12Member
    Joined: Dec 22, 2019

    Thank you po .. mejo hirap lang po ako sa paggamit ng template. Ano po bang tips to use it nicely. ang gingawa ko pp kase as in kung ano ung makita ko sa image un ung ipangbubuo ko sa template. tama po ba un ?

  • kkoalakkoala Posts: 62Member
    Joined: May 03, 2020

    @AAelaine said:
    Thank you po .. mejo hirap lang po ako sa paggamit ng template. Ano po bang tips to use it nicely. ang gingawa ko pp kase as in kung ano ung makita ko sa image un ung ipangbubuo ko sa template. tama po ba un ?

    Ginamit ko lang din po ang template nina sir @Heprex @steven etc., modified ng konti kung san ako comfortable. Then be flexible nalang sa different types ng charts. At first po may kodigo ako during practice, then sa sobrang paulit ulit po everyday, na-memorize ko na siya. Try to practice regularly po ng different types of charts like bar, pie, line, table, flow chart, map, & pictures.

    312111 | Architectural Draftsperson

    2020 Jul 14 - Submitted application to VETASSESS
    2020 Sep 07 - PTE Exam (Superior)
    2020 Sep 09 - Received positive outcome letter from VETASSESS
    2020 Sep 16 - Lodged EOI (sc491 - 95pts / sc190 - 85 pts)

    long wait during pandemic

    2022 May 12 - Pre-invite from NSW for sc491
    2022 May 19 - Submitted nomination application to NSW RDA Far South Coast
    2022 Jun 27 - ITA received, RDA nomination approved
    2022 Aug 21 - Lodged visa sc491
    2022 Aug 25 - Biometrics
    2022 Sep 10 - Medical
    2023 Feb 09 - Direct grant, no CO Contact

    2023 *** ** - Big move!

  • AAelaineAAelaine Posts: 12Member
    Joined: Dec 22, 2019

    Thank you po :) Praying na kayanin ko din .. aiming for 65 lang nman po ako .. hopefully makuha ko sia ng isang take .. Thank you and congrats po.. Godbless po sa inyo

    kkoalaEd510
  • bartowskibartowski Posts: 116Member
    Joined: Nov 26, 2018

    @kkoala said:

    @bartowski said:
    Hello po,

    Mamssirs, sino po naka-pag exam sa Trident recently? Ok lang po pa-share ng experiences nyo? Like kung naka-mask po ba kayo habang nageexam tapos kung ilan po kayo sa exam room, etc. TIA

    Hello! I took the exam last Sep. 7 sa Trident. Required ang face mask all throughout the exam. 8am yung sched ko and around 9-10 people kami, pero 2 separate rooms. Dulong cubicle ako and nasa 2 people lang naririnig ko during speaking part. Anticipate nalang po na maingay talaga sa exam room. By 3:30pm, may result na po kami. :)

    Thanks po. Next week na po exam ko, sana maka-superior.

    kkoala

    261312 - Developer Programmer | Age: 25| English Proficiency: 20 | Education: 15 |Work Experience: 15 | Spouse English Proficiency: 5 | Total 80
    Timeline:
    2018-Dec : Started Inquiring to Migration Agent
    2019-Jan : Signed contract with Migration Agent
    2019-Jan : Started collating documents for ACS
    2019-Mar : Lodged ACS assessment
    2019-Apr : Took First PTE Exam - (Not enough points)
    2019-May : Received ACS Assessment
    2019-Aug : Took 2nd PTE Exam - L -70 R-82 S-79 W-74
    2019-Sep : Lodged NSW EOI visa 190 and submitted Canberra Matrix
    2020-Apr : Scheduled PTE but due to pandemic I had to move it to 2020-November
    2020-Nov : Took 3rd PTE Exam - L -90 R-71 S-90 W-78
    2020-Dec : My wife took her PTE Exam(competent level)
    2021-Jan: Started collating Docs( For Renewal of ACS Assessment)
    2021-Nov: Took 4th PTE Exam (L-90 R-85 S-90 W-75)
    2022-Apr: Took 5th PTE Exam(L-89 R-82 S-90 W-76)
    2022-June: Lodged ACS Assessment( Developer Programmer)
    2022-June: Scheduled for 6th PTE Exam
    2022-June/July: Received PTE Exam Result(Superior) - L -83 R- 80 S -90 W-84
    2022-August: Received ACS Assessment( Positive Result but low points)
    2022-August: Lodged EOIs(491 - 85-90pts/ 190(80pts)/ 189 (75pts)
    2022-September: Submitted missing docs to ACS for Review
    2022-October: Received Updated ACS Assessment(with Higher points)
    2022-October: Updated EOIs(491 - 90-95pts/ 190 - 85pts / 189 - 80pts)
    2023-Jan.5 : Received Pre-Invite from Victoria
    2023-Jan.11 : Received ITA from Victoria
    2023-Feb-02 : VISA 190 Lodged

    "Anything is POSSIBLE!!!" - Kevin Garnett, 2008 NBA Finals

  • awinawin Posts: 13Member
    Joined: May 31, 2020

    Hi guys. Hihingi lang po ng advise kasi parang medyo nalabuan ako sa exam results ng PTE. Lahat po enabling skills ko is almost perfect pero ang baba ng score mismo. :( . Saan pa kaya po ako need magfocus?

    Engineering Technologist - 233914 | Age: 30 | English: 20 | Work: 10 | Education : 15 | De-Facto : 10 | NAATI: 5 | State: 5

    17 Mar 2020 - PTE, Proficient
    11 Sept 2020 - EAUST Positive Assessment Received
    14 Sept 2020 - EOI submitted for 189 - 85 pts
    10 Oct 2020 - PTE, Superior (Update 189 EOI)
    20 Aug 2021 - Passed the NAATI CCL Exam (EOI - 90 pts)
    12 Aug 2022 - ROI submitted for VIC 190
    23 Aug 2022 - Pre-invite received from VIC 190
    29 Aug 2022 - Nomination approved | Received ITA for VIC 190
    08 Sept 2022- Lodged 190 Visa (submitted Form 80)
    23 Sept 2022 - Submitted NBI Clearance
    03 Oct 2022 - Medical exam at St. Luke's BGC
    10 Oct 2022 - Medical exam Clearance

    18 Nov 2022 - Visa Grant - Offshore

    No CO Contact / Direct Grant

  • nashmacoy101nashmacoy101 Makati City
    Posts: 248Member
    Joined: Jul 13, 2017

    @awin said:
    Hi guys. Hihingi lang po ng advise kasi parang medyo nalabuan ako sa exam results ng PTE. Lahat po enabling skills ko is almost perfect pero ang baba ng score mismo. :( . Saan pa kaya po ako need magfocus?

    RWFIB at WFD

    ANZSCO 233211 | Civil Engineer
    07.09.2022 VISA GRANT (SC 190 NSW - 95PTS)
    09.08.2022 Qatar PCC
    18.06.2022 Medicals
    10.06.2022 Lodge Visa
    19.05.2022 Received final ITA from Skillselect
    18.05.2022 Received ITA from NSW and applied the same day
    16.05.2022 Created 3rd EOI
    27.04.2022 Received ITA from NSW (nasa junk folder kaya diko nakita, ayun expired link!)
    12.2021 Created 2nd EOI
    09.2020 Created 1st EOI pero na'lock kasi nakalimutan ko password at ung 3 questions KEK
    12.09.2020 PTE-A Wife (Proficient)
    07.09.2020 PTE-A L83 R90 S90 W90
    16.07.2020 Duplicate letter wife
    06.07.2020 RSEA outcome
    02.03.2020 PTE-A L75 R78 S85 W76
    01.2020 - back on track sa AU dream (sana magtuloy-tuloy na!)
    12.2017 - 12.2019: 2 years hiatus
    11.2017 EA outcome received
    08.2017 EA outcome letter wife

  • awinawin Posts: 13Member
    Joined: May 31, 2020

    @nashmacoy101 parang impossible pre. Confident kasi ako sa WFD at RWFIB since madami lumabas galing APEUNI. lalo na sa WFD, 3/4 galing APEUNI.

    herlipstickstain

    Engineering Technologist - 233914 | Age: 30 | English: 20 | Work: 10 | Education : 15 | De-Facto : 10 | NAATI: 5 | State: 5

    17 Mar 2020 - PTE, Proficient
    11 Sept 2020 - EAUST Positive Assessment Received
    14 Sept 2020 - EOI submitted for 189 - 85 pts
    10 Oct 2020 - PTE, Superior (Update 189 EOI)
    20 Aug 2021 - Passed the NAATI CCL Exam (EOI - 90 pts)
    12 Aug 2022 - ROI submitted for VIC 190
    23 Aug 2022 - Pre-invite received from VIC 190
    29 Aug 2022 - Nomination approved | Received ITA for VIC 190
    08 Sept 2022- Lodged 190 Visa (submitted Form 80)
    23 Sept 2022 - Submitted NBI Clearance
    03 Oct 2022 - Medical exam at St. Luke's BGC
    10 Oct 2022 - Medical exam Clearance

    18 Nov 2022 - Visa Grant - Offshore

    No CO Contact / Direct Grant

  • gzabalagzabala Dubai, UAE
    Posts: 153Member
    Joined: Jul 19, 2019

    hello,

    ask ko lang if meron ba answer key ang PTE scored test?
    thank in advance

  • xiaoxuexiaoxue Dubai
    Posts: 140Member
    Joined: Feb 23, 2020

    @awin said:
    @nashmacoy101 parang impossible pre. Confident kasi ako sa WFD at RWFIB since madami lumabas galing APEUNI. lalo na sa WFD, 3/4 galing APEUNI.

    Hi, sa ApeUni may part don na AI analysis. Try mo i-input don ung scores mo and isusuggest nia kung saan part ka dapat magfocus.

    _sebodemacho
  • _sebodemacho_sebodemacho Melbourne, VIC
    Posts: 1,045Member, Moderator
    Joined: Sep 13, 2019

    @xiaoxue said:

    @awin said:
    @nashmacoy101 parang impossible pre. Confident kasi ako sa WFD at RWFIB since madami lumabas galing APEUNI. lalo na sa WFD, 3/4 galing APEUNI.

    Hi, sa ApeUni may part don na AI analysis. Try mo i-input don ung scores mo and isusuggest nia kung saan part ka dapat magfocus.

    Nakakapag taka nga lang talaga na halos perfect yung enabling skills mo, pero hindi na-hit yung Superior mark.

    Pero agree ako sa suggestion to input your score in APEuni exam history. At least yan yung pwede mong option.

    DIY all the way. Avoid preachy, know-it-all, and unscrupulous agents AT ALL COSTS!


    "We must look for ways to be an active force in our own lives. We must take charge of our own destinies, design a life of substance and truly begin to live our dreams." - Les Brown


    261312 (Developer Programmer) - Main | 261111 (ICT Business Analyst) - Wife

    189 (95), 190 (100)


    2023

    14 Nov | BIG MOVE
    01 Nov | HIRED | First day of work. Remote working arrangement from SG
    --- Trying my luck at job hunting while in Singapore and BM planning on the side ---
    19 Apr | Direct Visa Grant | What a journey... JUST GRATEFUL!

    2022 - Pandemic Eases Off

    17 Nov | Medical Test Clearance
    15 Nov | Medical Test
    03 Nov | EOI #4, #6 | 189 Withdrawn, 190 NSW Withdrawn
    03 Nov | Visa Application | 190 VIC --- THE REAL WAITING GAME BEGINS!!!
    31 Oct | ITA | 190 VIC | never thought this day would come!!! T.T good decision to defer NSW nomination.
    27 Oct | Pre-ITA | 190 NSW --- sabi nila, when it rains, it pours!!!
    26 Oct | Nomination Application | 190 VIC
    26 Oct | Pre-ITA | 190 VIC --- one step closer, sa wakas, PADAYON!!!
    21 Oct | EOI #4, #5 + ROI, #6 DoE | 189, 190 VIC, 190 NSW
    21 Oct | ACS Assessment (Wife) Renewal - Suitable
    xx Mar| EOI#1, #2, #3 | 189 Expired, 190 NSW Expired, 190 VIC Expired

    2021 - Pandemic Still

    25 Sep | ACS Assessment (Main) Renewal - Suitable
    01 Feb | EOI#4 DoE | 189

    2020 - Pandemic

    19 Aug | EOI#1, #2, #3 DoE | 189, 190 NSW, 190 VIC
    30 Jul | NAATI CCL Online Test | Result: Passed
    09 Mar | PTE (Wife) | Results: L90 R80 S90 W82 (Superior)
    19 Feb | PTE (Main) | Results: L90 R83 S90 W82 (Superior)
    12 Feb | ACS Assessment (Wife) - Suitable | Expired

    2019

    24 Oct | ACS Assessment (Main) - Suitable | Expired

    2018

    --- Tons of research, document collection and other necessary preparations ---
    01 Sep | The Beginning | Had the chance to visit Oz, and immediately fell in love with it!

  • kkoalakkoala Posts: 62Member
    Joined: May 03, 2020

    @gzabala said:
    hello,

    ask ko lang if meron ba answer key ang PTE scored test?
    thank in advance

    I haven't tried the scored mock test by Pearson, sa 79score.com po ako nag-try kasi may free. May answer key and analytics page dun na makikita mo score per task. Like this one:

    xiaoxuegzabala

    312111 | Architectural Draftsperson

    2020 Jul 14 - Submitted application to VETASSESS
    2020 Sep 07 - PTE Exam (Superior)
    2020 Sep 09 - Received positive outcome letter from VETASSESS
    2020 Sep 16 - Lodged EOI (sc491 - 95pts / sc190 - 85 pts)

    long wait during pandemic

    2022 May 12 - Pre-invite from NSW for sc491
    2022 May 19 - Submitted nomination application to NSW RDA Far South Coast
    2022 Jun 27 - ITA received, RDA nomination approved
    2022 Aug 21 - Lodged visa sc491
    2022 Aug 25 - Biometrics
    2022 Sep 10 - Medical
    2023 Feb 09 - Direct grant, no CO Contact

    2023 *** ** - Big move!

  • gzabalagzabala Dubai, UAE
    Posts: 153Member
    Joined: Jul 19, 2019

    @kkoala said:

    @gzabala said:
    hello,

    ask ko lang if meron ba answer key ang PTE scored test?
    thank in advance

    I haven't tried the scored mock test by Pearson, sa 79score.com po ako nag-try kasi may free. May answer key and analytics page dun na makikita mo score per task. Like this one:

    thank you!

  • nashmacoy101nashmacoy101 Makati City
    Posts: 248Member
    Joined: Jul 13, 2017

    @_sebodemacho said:

    @xiaoxue said:

    @awin said:
    @nashmacoy101 parang impossible pre. Confident kasi ako sa WFD at RWFIB since madami lumabas galing APEUNI. lalo na sa WFD, 3/4 galing APEUNI.

    Hi, sa ApeUni may part don na AI analysis. Try mo i-input don ung scores mo and isusuggest nia kung saan part ka dapat magfocus.

    Nakakapag taka nga lang talaga na halos perfect yung enabling skills mo, pero hindi na-hit yung Superior mark.

    Pero agree ako sa suggestion to input your score in APEuni exam history. At least yan yung pwede mong option.

    @awin
    Even APEuni po RWFIB at WFD ang sinasuggest.

    kkoala

    ANZSCO 233211 | Civil Engineer
    07.09.2022 VISA GRANT (SC 190 NSW - 95PTS)
    09.08.2022 Qatar PCC
    18.06.2022 Medicals
    10.06.2022 Lodge Visa
    19.05.2022 Received final ITA from Skillselect
    18.05.2022 Received ITA from NSW and applied the same day
    16.05.2022 Created 3rd EOI
    27.04.2022 Received ITA from NSW (nasa junk folder kaya diko nakita, ayun expired link!)
    12.2021 Created 2nd EOI
    09.2020 Created 1st EOI pero na'lock kasi nakalimutan ko password at ung 3 questions KEK
    12.09.2020 PTE-A Wife (Proficient)
    07.09.2020 PTE-A L83 R90 S90 W90
    16.07.2020 Duplicate letter wife
    06.07.2020 RSEA outcome
    02.03.2020 PTE-A L75 R78 S85 W76
    01.2020 - back on track sa AU dream (sana magtuloy-tuloy na!)
    12.2017 - 12.2019: 2 years hiatus
    11.2017 EA outcome received
    08.2017 EA outcome letter wife

  • altuser41altuser41 Taguig
    Posts: 202Member
    Joined: Aug 28, 2013

    Maraming salamat sa mga generous ka-forums dito! Got my desired score today. Bilis ng result; 12PM available na agad.

    xiaoxuekkoalaiaiaiagzabalanashmacoy101baikenrose85

    261112 - Systems Analyst ( Age: 25 | Educ: 15 | Work: 15 | PTE - 20| Partner: 10 | NAATI: 5) Total: 90 pts.

    08/2013 | Got interested in Australia Migration
    09/2013 - 01/2019 | Our plan somehow stagnated
    01/2019 | ACS Assessment: Submitted
    02/2019 | ACS Assessment: Positive Result
    09/2020 | PTE: Superior Score
    09/2020 | EOI Submitted (75)
    10/2020 | Partner PTE: Proficient (+5)
    10/2020 | EOI Updated (80)
    11/2020 | NAATI CCL Exam
    12/2020 | NAATI CCL Exam: Positive Result! (+5)
    12/2020 | EOI Updated (85)
    12/2020 | Partner's ACS Assessment: Submitted
    02/2021 | Partner's ACS Assessment: Positive Result (+5)
    ?? / ???? | ITA
    ?? / ???? | Visa Grant

  • awinawin Posts: 13Member
    Joined: May 31, 2020

    Maraming salamat po sa mga sumagot sa question ko. :)

    Engineering Technologist - 233914 | Age: 30 | English: 20 | Work: 10 | Education : 15 | De-Facto : 10 | NAATI: 5 | State: 5

    17 Mar 2020 - PTE, Proficient
    11 Sept 2020 - EAUST Positive Assessment Received
    14 Sept 2020 - EOI submitted for 189 - 85 pts
    10 Oct 2020 - PTE, Superior (Update 189 EOI)
    20 Aug 2021 - Passed the NAATI CCL Exam (EOI - 90 pts)
    12 Aug 2022 - ROI submitted for VIC 190
    23 Aug 2022 - Pre-invite received from VIC 190
    29 Aug 2022 - Nomination approved | Received ITA for VIC 190
    08 Sept 2022- Lodged 190 Visa (submitted Form 80)
    23 Sept 2022 - Submitted NBI Clearance
    03 Oct 2022 - Medical exam at St. Luke's BGC
    10 Oct 2022 - Medical exam Clearance

    18 Nov 2022 - Visa Grant - Offshore

    No CO Contact / Direct Grant

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

CarlosCzarengrdkGeorgeLeeHezronrecardopinoisaudiboi8988iblessycardo suberiekxiaoluCORTESJAYJLEvaristonayabrayajpearlthefishthekneelawelynneislovelaurenceoliveralbaAybandanielTsiSenJuven1016rapsg
Browse Members

Members Online (0) + Guest (109)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌