Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

Case Officer (CO) Contact Thread

1123124126128129

Comments

  • superluckycloversuperluckyclover Melbourne, VIC
    Posts: 888Member
    Joined: Apr 27, 2015

    @agentKams said:
    @superluckyclover malapit lapit na iyan sis, next week may grant ka na niyan. :smile:

    THANK YOU SIS <3 Sana nga mabilis na lang rin pero anu pa man buti nareview na yung case namin

    Mark 11:24 Therefore I tell you, whatever you ask for in prayer, believe that you have received it, and it will be yours.

    261311 - Analyst Programmer | Age: 30 | Education: 15 | Australian Education: 5 | English Proficiency: 20 | NAATI CCL: 5 | Professional Year: 5 | Total: 80

    Timeline:
    26 Oct 2015 - Visa 573 Granted
    01 Nov 2015 - The Eagle has landed
    02 Nov 2015 - First Day High
    15 Feb 2017 - Hubby and Bubba joined me in Melbourne
    01 Dec 2017 - Graduated Masters!
    21 Mar 2018 - Visa 485 Granted
    20 Feb 2019 - Sat NAATI CCL Exam in Adelaide
    21 Mar 2019 - ACS Skills Assessment Positive, Qualification has been assessed as comparable to an AQF Master Degree with a Major in computing.
    23 Apr 2019 - Medicals Cleared - No actions required
    29 Apr 2019 - Submitted EOI for 189
    11 Jul 2019 - ITA received
    23 Jul 2019 - Lodged Visa 189! Speaking life over our PR application ♡
    04 Feb 2020 - CO Michael Contact (Asking for Evidence of NAATI CCL pass document, Status: Initial Assessment)
    04 Feb 2020 - Responded to CO Contact, attached evidence of NAATI CCL documents (Status: Further Assessment)
    04 Feb 2020 - Provided Compliment Feedback via DHA website
    06 Feb 2020 - Received Feedback Acknowledgement email from CO Sebastian
    06 Feb 2020 - Golden Visa Grant! PRAISE GOD!
    08 Apr 2022 - Received Citizenship Interview & Test Appointment letter
    27 Apr 2022 - Australian Citizenship by Conferral approved
    20 July 2022 - Australian Citizenship Oath Taking Whitehorse Council

  • lecialecia Posts: 1,841Member
    Joined: Nov 06, 2016

    @superluckyclover said:

    @agentKams said:
    @superluckyclover malapit lapit na iyan sis, next week may grant ka na niyan. :smile:

    THANK YOU SIS <3 Sana nga mabilis na lang rin pero anu pa man buti nareview na yung case namin

    Malapit na yan!! Nabuksan na file mo..

    superluckyclover

    "For I know the plans I have for you, declares the Lord, "plans to prosper you and not to harm you, plans to give you hope and a future"

    Age: 25 Language: 20 Experience: 15 Education: 15

    08/09/2017 - passed Australian Medical Scientist exam
    27/10/2017 - PTE LRSW- 77/80/75/85
    2018- got promoted, new job responsibilities,stop muna ang AUSSIE DREAM
    25/09/2018- PTE LRSW- 70/82/90/70 ( technical, ayaw magmove ng mouse ko sa listening, 2 WFD diko nasagot, submitted report\complain pero wala din)
    17/10/2018- PTE LRSW- 84/77/90/84
    09/02/2019- PTE LRSW- 83/82/90/85
    10/02/2019 -EOI lodge 75 (189) 80 (190)
    11/02/2019 - ITA received 189 ( 75 points)
    12/02/2019 - NSW ITA received 190 ( 80 points)
    19/02/2019 - SG PCC released
    20/02/2019 - Medical at SATA Ang Mo Kio @6-9 pm night clinic
    23/02/2019 - Visa lodged 189
    06/03/2019 - NBI provided ( umuwi ako Pinas kasi sa online Last name ni husband nag aapear, di pa ako nagchange ng married name ko kaya gusto ko kapareho nun passport at iba pang docs ko. Pag sa Pinas, pinakita ko lang passport ko at yun nirelease nila.

  • extremestylemanextremestyleman Sydney
    Posts: 93Member
    Joined: Apr 04, 2019

    Good PM. Ask ko lang sana if may na CO contact dahil wala syang Polio Vaccine Cert. Thanks.

    ANZSCO 263311 | Telecommunications Engineer | Age : 25 , Education: 15, Experience: 15, PTE: 20 Skilled Spouse: 5 | 80 Points
    01.04.2019 | My wife and I talked and agreed to take a shot to try to migrate in Australia.
    03.20.2019 | PTE-A |LRSW|90/81/90/80| 1st take Superior thanks God!
    04.14.2019 | Lodged EA Assessment with RSEA and fast track
    05.14.2019 | EA Result : POSITIVE with 8 years experience
    05.14.2019 | EOI 189 75 points
    05.31.2019 | EOI 189 80 points (updated) with Skilled Spouse
    10.11.2019 | 189 Invitation Received
    10.30.2019 | NBI Clearance Issued
    10.31.2019 | Medicals
    11.02.2019 | Visa Lodged
    11.06.2019 | Health Clearance Provided - No Actions Required
    02.11.2020 | Visa Grant
    05.26.2020 | BM

  • superluckycloversuperluckyclover Melbourne, VIC
    Posts: 888Member
    Joined: Apr 27, 2015

    @lecia said:

    @superluckyclover said:

    @agentKams said:
    @superluckyclover malapit lapit na iyan sis, next week may grant ka na niyan. :smile:

    THANK YOU SIS <3 Sana nga mabilis na lang rin pero anu pa man buti nareview na yung case namin

    Malapit na yan!! Nabuksan na file mo..

    Thanks sis @lecia ! Sana nga mabilis na lang at nag feedback na rin ako! :-)

    Mark 11:24 Therefore I tell you, whatever you ask for in prayer, believe that you have received it, and it will be yours.

    261311 - Analyst Programmer | Age: 30 | Education: 15 | Australian Education: 5 | English Proficiency: 20 | NAATI CCL: 5 | Professional Year: 5 | Total: 80

    Timeline:
    26 Oct 2015 - Visa 573 Granted
    01 Nov 2015 - The Eagle has landed
    02 Nov 2015 - First Day High
    15 Feb 2017 - Hubby and Bubba joined me in Melbourne
    01 Dec 2017 - Graduated Masters!
    21 Mar 2018 - Visa 485 Granted
    20 Feb 2019 - Sat NAATI CCL Exam in Adelaide
    21 Mar 2019 - ACS Skills Assessment Positive, Qualification has been assessed as comparable to an AQF Master Degree with a Major in computing.
    23 Apr 2019 - Medicals Cleared - No actions required
    29 Apr 2019 - Submitted EOI for 189
    11 Jul 2019 - ITA received
    23 Jul 2019 - Lodged Visa 189! Speaking life over our PR application ♡
    04 Feb 2020 - CO Michael Contact (Asking for Evidence of NAATI CCL pass document, Status: Initial Assessment)
    04 Feb 2020 - Responded to CO Contact, attached evidence of NAATI CCL documents (Status: Further Assessment)
    04 Feb 2020 - Provided Compliment Feedback via DHA website
    06 Feb 2020 - Received Feedback Acknowledgement email from CO Sebastian
    06 Feb 2020 - Golden Visa Grant! PRAISE GOD!
    08 Apr 2022 - Received Citizenship Interview & Test Appointment letter
    27 Apr 2022 - Australian Citizenship by Conferral approved
    20 July 2022 - Australian Citizenship Oath Taking Whitehorse Council

  • angel14angel14 Posts: 84Member
    Joined: May 17, 2018

    @lecia said:

    @angel14 said:
    question po regarding medical, talaga bang wala tayong need iupload after magpamedical? like for example nagpa medical kami st lukes and sabi nila sila na raw magsend sa australian embassy.

    Oo sila na po send sa Au, just input the Hap Id provided at yunh emedical info sheet, andun na yung Hap id mo...

    Thank you. Baka kasi hinahantay yung ng CO eh wala naman kaming nakuha from St Lukes.

    PTE Nov 13, 2018
    ACS Assessment Application Nov 27, 2018
    ACS + assessment results Feb 12, 2019
    EOI Lodge Application SA July 9, 2019
    ITA Received SA Aug 25, 2019
    Visa Lodge SA Sept 11, 2019
    CO Contact (Medical and Police Clearance) Dec 12, 2019
    Medical Dec 18, 2019
    Police/NBI Clearance Jan 13, 2020
    Visa Grant Feb 13, 2020

  • von1xxvon1xx Posts: 127Member
    Joined: Jun 09, 2016

    @angel14 sa immiaccount nyo po under ng health makikita po ung submitted pag sinend na ng clinic ung medical results.

    263213 - Age: 30 | Education: 15 | Experience: 5 | English: 20 | Total: 70 pts

    20.09.17 | Started collating documents for ACS Assessment
    22.11.18 | Collected all documents for ACS Assessment
    26.11.18 | Submitted ACS Skills Assessment
    11.01.19 | Received ACS Result - Positive - 2Yrs Deducted
    02.02.19 | PTE - L71/R78/S82/W73 - Proficient
    02.03.19 | PTE - L73/R79/S90/W74 - Proficient+
    23.03.19 | PTE - L73/R84/S84/W86 - Proficient+
    13.04.19 | PTE - L77/R90/S80/W90 - Proficient+
    04.05.19 | PTE - L79/R81/S87/W90 - Superior
    07.05.19 | Submitted ACS Skills Re-Assessment to add new work
    06.06.19 | Received ACS Result - Positive - 2Yrs Deducted
    06.06.19 | Submitted State Nomination & EOI SA 489 (80)
    20.07.19 | Received ITA SA 489
    21.07.19 | SG COC eAppeal
    22.07.19 | SG COC Application
    24.07.19 | Medicals
    25.07.19 | Health Clearance Provided - no action required
    29.07.19 | SG COC Issued
    30.07.19 | Visa Lodged
    02.09.19 | NBI Clearance Issued
    14.11.19 | Visa Grant - Thank you Lord!
    22.02.20 | Big Move
    25.02.22 | Visa 887 Lodged
    02.03.23 | Visa Grant - Thank you Lord!

  • superluckycloversuperluckyclover Melbourne, VIC
    Posts: 888Member
    Joined: Apr 27, 2015

    May mga batchmate ba ako sa thread na ito? Hehe! Sinubukan ko yung #TeamFeedback, alam ko maaga pa para mag feedback pero gusto ko lang magpa-pampam sa DHA! Compliment muna binigay ko (kahit angsakit ma overlook nung NAATI doc ko) then this afternoon nag respond si Sebastian (close kunwari kami) Nag thank you! Hahahaha ❤️

    Mark 11:24 Therefore I tell you, whatever you ask for in prayer, believe that you have received it, and it will be yours.

    261311 - Analyst Programmer | Age: 30 | Education: 15 | Australian Education: 5 | English Proficiency: 20 | NAATI CCL: 5 | Professional Year: 5 | Total: 80

    Timeline:
    26 Oct 2015 - Visa 573 Granted
    01 Nov 2015 - The Eagle has landed
    02 Nov 2015 - First Day High
    15 Feb 2017 - Hubby and Bubba joined me in Melbourne
    01 Dec 2017 - Graduated Masters!
    21 Mar 2018 - Visa 485 Granted
    20 Feb 2019 - Sat NAATI CCL Exam in Adelaide
    21 Mar 2019 - ACS Skills Assessment Positive, Qualification has been assessed as comparable to an AQF Master Degree with a Major in computing.
    23 Apr 2019 - Medicals Cleared - No actions required
    29 Apr 2019 - Submitted EOI for 189
    11 Jul 2019 - ITA received
    23 Jul 2019 - Lodged Visa 189! Speaking life over our PR application ♡
    04 Feb 2020 - CO Michael Contact (Asking for Evidence of NAATI CCL pass document, Status: Initial Assessment)
    04 Feb 2020 - Responded to CO Contact, attached evidence of NAATI CCL documents (Status: Further Assessment)
    04 Feb 2020 - Provided Compliment Feedback via DHA website
    06 Feb 2020 - Received Feedback Acknowledgement email from CO Sebastian
    06 Feb 2020 - Golden Visa Grant! PRAISE GOD!
    08 Apr 2022 - Received Citizenship Interview & Test Appointment letter
    27 Apr 2022 - Australian Citizenship by Conferral approved
    20 July 2022 - Australian Citizenship Oath Taking Whitehorse Council

  • Devi@nt19Devi@nt19 Mandaluyong
    Posts: 158Member
    Joined: Sep 19, 2018

    HI @superluckyclover! Nice! :) pano ka nagfeedback? nimention mo name ng CO mo? Ako din na CO contact eh. Plan ko din mag feedback pero after grant siguro. ehehe. na CO ako for staying naman sa other US for only 4months. Niaask ako FBI PCC. Nagccomply na lang ako. tumawag na ako sa kanila ang sinabi lang if hinihingi baka daw may reason si CO so if makukuha daw naman, kuha na lang. Un. so comply comply na lang muna kahit wala ako nakuha maayos na explanation. :) I believe my purpose/reason naman lahat.

    (261313 | Age: 30 | Employment: 15| BS Degree: 15 | English: 20 | Total:80)

    July 29, 2018 - IELTS : Competent
    October 3, 2018 - Submit ACS assessment
    Dec 07, 2018 - ACS assessment result - Associate Degree
    February 4, 2019 - Re-appeal to ACS for incorrect assessment
    February 15, 2019 - ACS Dispute Result - Positive outcome. Bachelors Degree
    February 23, 2019 - 1st take PTE-A : Superior
    February 28, 2019 - Submitted EOI for 189
    March 10, 2019 - ITA for 189 Received
    March 27, 2019 - Medicals at NHSI
    March 29, 2019 - Medicals No Actions Required
    April 17, 2019 - Visa Lodged
    January 30, 2020 - CO Contact: FBI clearance
    February 13, 2020 - Responded to CO contact
    March 17, 2020 - Updated NBI (Police) Clearance
    May 20, 2021 - CO Contact: Re-do Medical, Re-do Police Clearance
    June 7, 2021 - Medicals (2nd) at NHSI
    June 9, 2021 - Medicals No Actions Required
    June 14, 2021 - Updated NBI (Police) Clearance and responded to CO contact
    June 21, 2021 - Visa Grant
    Q1 2022 - Big Move

  • superluckycloversuperluckyclover Melbourne, VIC
    Posts: 888Member
    Joined: Apr 27, 2015
    edited February 2020

    @Devi@nt19 said:
    HI @superluckyclover! Nice! :) pano ka nagfeedback? nimention mo name ng CO mo? Ako din na CO contact eh. Plan ko din mag feedback pero after grant siguro. ehehe. na CO ako for staying naman sa other US for only 4months. Niaask ako FBI PCC. Nagccomply na lang ako. tumawag na ako sa kanila ang sinabi lang if hinihingi baka daw may reason si CO so if makukuha daw naman, kuha na lang. Un. so comply comply na lang muna kahit wala ako nakuha maayos na explanation. :) I believe my purpose/reason naman lahat.

    Nagback read ako rito sa thread na ito. Back in 2018, nagtipon ang mga na CO sa different visas :smile: ayun sana dahil wala naman masyadong applicants for 189 for the year 2019, mabilis mabalikan tayong mga na-CO contact. August 20 ata yung na grant 2 days ago as per Filipino batch. (May theory kasi na ang processing ng CO ay per country as domain knowledge)

    Yung #TeamFeedback, parang magical technique (hehe I don’t know the perfect term) mula kay legendary @Heprex. Nakakahelp sya lalo na sa may experience tulad ng technical glitch sa medicals, mga naoverlook na documents, etc. For some people na nag feedback, nabalikan sila agad ng CO tapos binigyan ng grant agad.

    Paste ko dito instructions pano. All the best sa FBI police clearance mo @Devi@nt19 , mabilis na lang yan

    Mark 11:24 Therefore I tell you, whatever you ask for in prayer, believe that you have received it, and it will be yours.

    261311 - Analyst Programmer | Age: 30 | Education: 15 | Australian Education: 5 | English Proficiency: 20 | NAATI CCL: 5 | Professional Year: 5 | Total: 80

    Timeline:
    26 Oct 2015 - Visa 573 Granted
    01 Nov 2015 - The Eagle has landed
    02 Nov 2015 - First Day High
    15 Feb 2017 - Hubby and Bubba joined me in Melbourne
    01 Dec 2017 - Graduated Masters!
    21 Mar 2018 - Visa 485 Granted
    20 Feb 2019 - Sat NAATI CCL Exam in Adelaide
    21 Mar 2019 - ACS Skills Assessment Positive, Qualification has been assessed as comparable to an AQF Master Degree with a Major in computing.
    23 Apr 2019 - Medicals Cleared - No actions required
    29 Apr 2019 - Submitted EOI for 189
    11 Jul 2019 - ITA received
    23 Jul 2019 - Lodged Visa 189! Speaking life over our PR application ♡
    04 Feb 2020 - CO Michael Contact (Asking for Evidence of NAATI CCL pass document, Status: Initial Assessment)
    04 Feb 2020 - Responded to CO Contact, attached evidence of NAATI CCL documents (Status: Further Assessment)
    04 Feb 2020 - Provided Compliment Feedback via DHA website
    06 Feb 2020 - Received Feedback Acknowledgement email from CO Sebastian
    06 Feb 2020 - Golden Visa Grant! PRAISE GOD!
    08 Apr 2022 - Received Citizenship Interview & Test Appointment letter
    27 Apr 2022 - Australian Citizenship by Conferral approved
    20 July 2022 - Australian Citizenship Oath Taking Whitehorse Council

  • superluckycloversuperluckyclover Melbourne, VIC
    Posts: 888Member
    Joined: Apr 27, 2015

    https://pinoyau.info/discussion/comment/282580/#Comment_282580

    @Devi@nt19 here’s the link for your reference.

    Salamat din po kay Mr/Mrs @Heprex sa tip na ito. Sana mag work din samin ❤️💙💜💛💚🧡

    Mark 11:24 Therefore I tell you, whatever you ask for in prayer, believe that you have received it, and it will be yours.

    261311 - Analyst Programmer | Age: 30 | Education: 15 | Australian Education: 5 | English Proficiency: 20 | NAATI CCL: 5 | Professional Year: 5 | Total: 80

    Timeline:
    26 Oct 2015 - Visa 573 Granted
    01 Nov 2015 - The Eagle has landed
    02 Nov 2015 - First Day High
    15 Feb 2017 - Hubby and Bubba joined me in Melbourne
    01 Dec 2017 - Graduated Masters!
    21 Mar 2018 - Visa 485 Granted
    20 Feb 2019 - Sat NAATI CCL Exam in Adelaide
    21 Mar 2019 - ACS Skills Assessment Positive, Qualification has been assessed as comparable to an AQF Master Degree with a Major in computing.
    23 Apr 2019 - Medicals Cleared - No actions required
    29 Apr 2019 - Submitted EOI for 189
    11 Jul 2019 - ITA received
    23 Jul 2019 - Lodged Visa 189! Speaking life over our PR application ♡
    04 Feb 2020 - CO Michael Contact (Asking for Evidence of NAATI CCL pass document, Status: Initial Assessment)
    04 Feb 2020 - Responded to CO Contact, attached evidence of NAATI CCL documents (Status: Further Assessment)
    04 Feb 2020 - Provided Compliment Feedback via DHA website
    06 Feb 2020 - Received Feedback Acknowledgement email from CO Sebastian
    06 Feb 2020 - Golden Visa Grant! PRAISE GOD!
    08 Apr 2022 - Received Citizenship Interview & Test Appointment letter
    27 Apr 2022 - Australian Citizenship by Conferral approved
    20 July 2022 - Australian Citizenship Oath Taking Whitehorse Council

  • Devi@nt19Devi@nt19 Mandaluyong
    Posts: 158Member
    Joined: Sep 19, 2018

    @superluckyclover said:
    https://pinoyau.info/discussion/comment/282580/#Comment_282580

    @Devi@nt19 here’s the link for your reference.

    Salamat din po kay Mr/Mrs @Heprex sa tip na ito. Sana mag work din samin ❤️💙💜💛💚🧡

    Salamat @superluckyclover!
    Magbackread din ako this weekend. hehe.. kakasend ko lang via DHL ng docs for FBI PCC to US. waiting game na ulet. :) Try ko sundan mga yapak nyo ni boss @Heprex @superluckyclover. Praying for the best. o:)

    superluckyclover

    (261313 | Age: 30 | Employment: 15| BS Degree: 15 | English: 20 | Total:80)

    July 29, 2018 - IELTS : Competent
    October 3, 2018 - Submit ACS assessment
    Dec 07, 2018 - ACS assessment result - Associate Degree
    February 4, 2019 - Re-appeal to ACS for incorrect assessment
    February 15, 2019 - ACS Dispute Result - Positive outcome. Bachelors Degree
    February 23, 2019 - 1st take PTE-A : Superior
    February 28, 2019 - Submitted EOI for 189
    March 10, 2019 - ITA for 189 Received
    March 27, 2019 - Medicals at NHSI
    March 29, 2019 - Medicals No Actions Required
    April 17, 2019 - Visa Lodged
    January 30, 2020 - CO Contact: FBI clearance
    February 13, 2020 - Responded to CO contact
    March 17, 2020 - Updated NBI (Police) Clearance
    May 20, 2021 - CO Contact: Re-do Medical, Re-do Police Clearance
    June 7, 2021 - Medicals (2nd) at NHSI
    June 9, 2021 - Medicals No Actions Required
    June 14, 2021 - Updated NBI (Police) Clearance and responded to CO contact
    June 21, 2021 - Visa Grant
    Q1 2022 - Big Move

  • superluckycloversuperluckyclover Melbourne, VIC
    Posts: 888Member
    Joined: Apr 27, 2015

    Update ko lang po! We got our grant today, 2:38 pm. Fresh na fresh from DHA. Mabuhay ang Feedback!!!

    Mark 11:24 Therefore I tell you, whatever you ask for in prayer, believe that you have received it, and it will be yours.

    261311 - Analyst Programmer | Age: 30 | Education: 15 | Australian Education: 5 | English Proficiency: 20 | NAATI CCL: 5 | Professional Year: 5 | Total: 80

    Timeline:
    26 Oct 2015 - Visa 573 Granted
    01 Nov 2015 - The Eagle has landed
    02 Nov 2015 - First Day High
    15 Feb 2017 - Hubby and Bubba joined me in Melbourne
    01 Dec 2017 - Graduated Masters!
    21 Mar 2018 - Visa 485 Granted
    20 Feb 2019 - Sat NAATI CCL Exam in Adelaide
    21 Mar 2019 - ACS Skills Assessment Positive, Qualification has been assessed as comparable to an AQF Master Degree with a Major in computing.
    23 Apr 2019 - Medicals Cleared - No actions required
    29 Apr 2019 - Submitted EOI for 189
    11 Jul 2019 - ITA received
    23 Jul 2019 - Lodged Visa 189! Speaking life over our PR application ♡
    04 Feb 2020 - CO Michael Contact (Asking for Evidence of NAATI CCL pass document, Status: Initial Assessment)
    04 Feb 2020 - Responded to CO Contact, attached evidence of NAATI CCL documents (Status: Further Assessment)
    04 Feb 2020 - Provided Compliment Feedback via DHA website
    06 Feb 2020 - Received Feedback Acknowledgement email from CO Sebastian
    06 Feb 2020 - Golden Visa Grant! PRAISE GOD!
    08 Apr 2022 - Received Citizenship Interview & Test Appointment letter
    27 Apr 2022 - Australian Citizenship by Conferral approved
    20 July 2022 - Australian Citizenship Oath Taking Whitehorse Council

  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016

    @superluckyclover congrats. 2020 na pero glad its worth something pa din. Hehe

    superluckyclover

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • superluckycloversuperluckyclover Melbourne, VIC
    Posts: 888Member
    Joined: Apr 27, 2015

    @Heprex said:
    @superluckyclover congrats. 2020 na pero glad its worth something pa din. Hehe

    Salamat po talaga sainyo :smile:

    Mark 11:24 Therefore I tell you, whatever you ask for in prayer, believe that you have received it, and it will be yours.

    261311 - Analyst Programmer | Age: 30 | Education: 15 | Australian Education: 5 | English Proficiency: 20 | NAATI CCL: 5 | Professional Year: 5 | Total: 80

    Timeline:
    26 Oct 2015 - Visa 573 Granted
    01 Nov 2015 - The Eagle has landed
    02 Nov 2015 - First Day High
    15 Feb 2017 - Hubby and Bubba joined me in Melbourne
    01 Dec 2017 - Graduated Masters!
    21 Mar 2018 - Visa 485 Granted
    20 Feb 2019 - Sat NAATI CCL Exam in Adelaide
    21 Mar 2019 - ACS Skills Assessment Positive, Qualification has been assessed as comparable to an AQF Master Degree with a Major in computing.
    23 Apr 2019 - Medicals Cleared - No actions required
    29 Apr 2019 - Submitted EOI for 189
    11 Jul 2019 - ITA received
    23 Jul 2019 - Lodged Visa 189! Speaking life over our PR application ♡
    04 Feb 2020 - CO Michael Contact (Asking for Evidence of NAATI CCL pass document, Status: Initial Assessment)
    04 Feb 2020 - Responded to CO Contact, attached evidence of NAATI CCL documents (Status: Further Assessment)
    04 Feb 2020 - Provided Compliment Feedback via DHA website
    06 Feb 2020 - Received Feedback Acknowledgement email from CO Sebastian
    06 Feb 2020 - Golden Visa Grant! PRAISE GOD!
    08 Apr 2022 - Received Citizenship Interview & Test Appointment letter
    27 Apr 2022 - Australian Citizenship by Conferral approved
    20 July 2022 - Australian Citizenship Oath Taking Whitehorse Council

  • donyxdonyx Philippines
    Posts: 393Member
    Joined: Jul 04, 2017

    @superluckyclover sana gumana rin saken yung #teamfeedback. abangers mode na ulit kami hahaha

    superluckyclover

    233513 - Production or Plant Engineer | Age: 30 | Education: 15 | English: 20 | Experience: 15 | Total: 80

    December 2, 2017 - IELTS (L: 8.0, R: 9.0, W: 6.0, S: 7.0) Competent
    September 17, 2018 - Lodge CDR+RSEA, Fast Track
    October 9, 2018 - EA Contact, additional requirements
    October 16, 2018 - Positive outcome
    December 3, 2018 - 1st take PTE-A (L: 86, R: 90, W: 90, S: 90) Superior
    February 18, 2019 - Submitted EOI for 189
    March 10, 2019 - ITA for 189 Received
    April 6, 2019 - Medicals (1st, Expired)
    April 10, 2019 - Medicals No Actions Required
    April 17, 2019 - Visa Lodged
    January 10, 2020 - Updated passport details
    January 30, 2020 - CO Contact: Evidence of Relationship
    February 6, 2020 - Responded to CO
    March 4, 2020 - Updated NBI (Police) Clearance
    May 20, 2021 - CO Contact: Re-do Medical, Re-do Police Clearance
    June 7, 2021 - Medicals (2nd)
    June 8, 2021 - Updated NBI (Police) Clearance
    June 9, 2021 - Medicals No Actions Required
    June 21, 2021 - Visa Grant
    January 9, 2022 - Big Move

  • Noodles12Noodles12 Sydney
    Posts: 495Member
    Joined: May 12, 2016

    @Heprex said:
    @superluckyclover congrats. 2020 na pero glad its worth something pa din. Hehe

    HAHAHAHA ayan si @Heprex ang founder ng #TeamFeedback. hahahaha

    superluckyclover

    261312 - Developer Programmer
    May 2016 - Started gathering ACS requirements
    May 2016 - IELTS self review
    Jun 2016 - PTE-A self review (Haven't decided which one will choose between IELTS and PTE)
    Jun 16 2016 - Completed employment references for ACS assessment.
    Jun 28 2016 - Submitted requirements to ACS
    Jul 08 2016 - Received ACS Result. (AQF Bachelor Degree with a major in computing, 7yrs ++ years credited. sayang nde pa naging 8yrs)
    Sep 08 2016 - IELTS Speaking Test
    Sep 10 2016 - IELTS Listening, Reading and Writing Test
    Sep 23 2016 - IELTS Result (L7.5, R7, S8, W6.5) :(
    Sep 26 2016 - Applied for remarking
    Nov 30 2016 - Got result for remarking, score did not changed (wasted precious time)
    Dec 20 2016 - Took PTE-A Exam
    Dec 21 2016 - Got PTE Result (L 77, R, 70, S 82, W 80) Thank God!
    Dec 27 2016 - Submitted EOI 189 (65pts)
    Feb 2, 2017 - EOI pts updated to 70 pts due to 8yrs work experience milestone.
    Feb 15, 2017 - Invited to lodge
    March 25, 2017 - Medical at Nationwide Makati
    Apr 11, 2017 - Lodge Application
    Apr 12, 2017 - Front loaded Docs
    May 2, 2017 - CO Contact GSM Adelaide - Requesting for additional Employment evidence, Health Dec for child, Additional De facto Evidence, Consent for Child.
    May 15, 2017 - Submitted all docs requested by CO.
    Aug 10, 2017 - Second CO contact requesting for partner's evidence of functional English (even though we submitted this during lodging)
    Aug 11, 2017 - Submitted CO requested document.
    Nov 1, 2017 3rd CO Contact requesting for new medical exam for daughter since the TB test already expired.

    (panong nde ma eexpire eh ang tagal tagal na namin nag lodge. Malapit nadin mag expire yung NBI clearance ko so sa 4th CO contact rerequest naman ng new NBI clearance?)

    Nov 11, 2017 - Medical of daughter
    Jan 12, 2017 - Submitted New NBI Clearance
    Jan 17, 2018 - 4th CO Contact requesting for Health undertaking form for our daughter. Submit the form the same day.
    Feb 20, 2018 - Sent Feedback to DIBP regarding how slow the processing of the CO.
    Feb 21, 2018 - Grant Received!!!
    May 11, 2018 - Initial Entry at Sydney
    Dec 2018 or Jan 2019 Tentative big move!

  • anikaarkin0915anikaarkin0915 Philippines
    Posts: 22Member
    Joined: Mar 27, 2019

    Good day po sa lahat. Baka lang po meron pwedeng makatulong sa amin na napagdaanan na yung concern Namin sa ngayon regarding additional requirements from the CO. Yung wife ko po kasi ay hinihingian ng Police clearance from Saudi dahil nag work sya dun 7yrs ago, hindi po namin alam pano nkakapag obtain ng Pcc Saudi kasi wala naman siya/kami kakilala dun at Isa pa wala naman sya copy ng nung iqama nya or resident permit. Sana po may makatulong kung ano pwede naming gawin or alternatives. Salamat po ng marami

  • cuccicucci NSW
    Posts: 981Member
    Joined: Jan 27, 2018
    edited February 2020

    @anikaarkin0915 said:
    Good day po sa lahat. Baka lang po meron pwedeng makatulong sa amin na napagdaanan na yung concern Namin sa ngayon regarding additional requirements from the CO. Yung wife ko po kasi ay hinihingian ng Police clearance from Saudi dahil nag work sya dun 7yrs ago, hindi po namin alam pano nkakapag obtain ng Pcc Saudi kasi wala naman siya/kami kakilala dun at Isa pa wala naman sya copy ng nung iqama nya or resident permit. Sana po may makatulong kung ano pwede naming gawin or alternatives. Salamat po ng marami

    Medyo mahirap po ang situation nyo. Ano ba documents na na-gather na ni wifey mo? Kung mahihirapan na talaga the last option might be to supply a Character Statutory Declaration together with a letter explaining your situation.

    ++++++++++++++++++++++++
    07.2016 | IELTS
    01.2017 | Applied to AHPRA
    04.2017 | received Letter of Referral
    09.2017 | finished BP
    11.2017 | AHPRA Registration / Employment Offer
    12.2017 | Lodged 457 Visa Application (onshore) / ANMAC Assessment
    01.2018 | 457 Visa granted / Received positive ANMAC Assessment / Submitted EOI

    04.11.2019 | Received Employer Nomination
    04.26.2019 | Submitted Visa application (186 DE)
    05.06.2019 | CO contact for medical exams
    05.09.2019 | Visa Granted (186 DE)

    17.09.2021 | Application for Citizenship
    21.03.2022 | Citizenship exam, interview and approval
    02.07.2022 | Citizenship Ceremony
    (Thank you Lord!!!)

    21.03.2023 | Citizenship interview, exam and approval of dependents
    ++++++++++++++++++++++++

  • lecialecia Posts: 1,841Member
    Joined: Nov 06, 2016

    @anikaarkin0915 said:
    Good day po sa lahat. Baka lang po meron pwedeng makatulong sa amin na napagdaanan na yung concern Namin sa ngayon regarding additional requirements from the CO. Yung wife ko po kasi ay hinihingian ng Police clearance from Saudi dahil nag work sya dun 7yrs ago, hindi po namin alam pano nkakapag obtain ng Pcc Saudi kasi wala naman siya/kami kakilala dun at Isa pa wala naman sya copy ng nung iqama nya or resident permit. Sana po may makatulong kung ano pwede naming gawin or alternatives. Salamat po ng marami

    Check mo sa site ng DHA how to obtain PCC from Saudi.. Middle East din ako dati, pero hindi Saudi, nag send ako passport copy at exit visa stamp ko, nag bank transfer then na receive ko sya 3 weeks after..

    Meron dito thread ng Middle East, hanapin mo na lang. madaming tips doon.

    "For I know the plans I have for you, declares the Lord, "plans to prosper you and not to harm you, plans to give you hope and a future"

    Age: 25 Language: 20 Experience: 15 Education: 15

    08/09/2017 - passed Australian Medical Scientist exam
    27/10/2017 - PTE LRSW- 77/80/75/85
    2018- got promoted, new job responsibilities,stop muna ang AUSSIE DREAM
    25/09/2018- PTE LRSW- 70/82/90/70 ( technical, ayaw magmove ng mouse ko sa listening, 2 WFD diko nasagot, submitted report\complain pero wala din)
    17/10/2018- PTE LRSW- 84/77/90/84
    09/02/2019- PTE LRSW- 83/82/90/85
    10/02/2019 -EOI lodge 75 (189) 80 (190)
    11/02/2019 - ITA received 189 ( 75 points)
    12/02/2019 - NSW ITA received 190 ( 80 points)
    19/02/2019 - SG PCC released
    20/02/2019 - Medical at SATA Ang Mo Kio @6-9 pm night clinic
    23/02/2019 - Visa lodged 189
    06/03/2019 - NBI provided ( umuwi ako Pinas kasi sa online Last name ni husband nag aapear, di pa ako nagchange ng married name ko kaya gusto ko kapareho nun passport at iba pang docs ko. Pag sa Pinas, pinakita ko lang passport ko at yun nirelease nila.

  • anikaarkin0915anikaarkin0915 Philippines
    Posts: 22Member
    Joined: Mar 27, 2019

    Hello po sa lahat

  • anikaarkin0915anikaarkin0915 Philippines
    Posts: 22Member
    Joined: Mar 27, 2019

    Salamat po sa inputs. Meron lang po sya entry/exit stamp sa passport and Coe from her previous employer sa Saudi. In regards po sa statutory declaration kailangan ko po ba inform yung CO first bago po yun? Pasensiya na po medyo confuse lang kasi kung sino po ang dapat na signatory sa stat declaration and kung saan po kukuha? Marami pong salamat.

  • cuccicucci NSW
    Posts: 981Member
    Joined: Jan 27, 2018

    @anikaarkin0915 said:
    Salamat po sa inputs. Meron lang po sya entry/exit stamp sa passport and Coe from her previous employer sa Saudi. In regards po sa statutory declaration kailangan ko po ba inform yung CO first bago po yun? Pasensiya na po medyo confuse lang kasi kung sino po ang dapat na signatory sa stat declaration and kung saan po kukuha? Marami pong salamat.

    Pag sa Pinas gagawin, the Stat Dec can be in Affidavit format... empre ang signatory ay yung wife mo dahil ang declaration is about her character...

    attached is Stat Dec in Affidavit format.

    ++++++++++++++++++++++++
    07.2016 | IELTS
    01.2017 | Applied to AHPRA
    04.2017 | received Letter of Referral
    09.2017 | finished BP
    11.2017 | AHPRA Registration / Employment Offer
    12.2017 | Lodged 457 Visa Application (onshore) / ANMAC Assessment
    01.2018 | 457 Visa granted / Received positive ANMAC Assessment / Submitted EOI

    04.11.2019 | Received Employer Nomination
    04.26.2019 | Submitted Visa application (186 DE)
    05.06.2019 | CO contact for medical exams
    05.09.2019 | Visa Granted (186 DE)

    17.09.2021 | Application for Citizenship
    21.03.2022 | Citizenship exam, interview and approval
    02.07.2022 | Citizenship Ceremony
    (Thank you Lord!!!)

    21.03.2023 | Citizenship interview, exam and approval of dependents
    ++++++++++++++++++++++++

  • anikaarkin0915anikaarkin0915 Philippines
    Posts: 22Member
    Joined: Mar 27, 2019

    Ok lang po ba kung kahit saang law office magpagawa nitong affidavit? or magpa notary? Salamat po ulit ma'am.

  • cuccicucci NSW
    Posts: 981Member
    Joined: Jan 27, 2018

    @anikaarkin0915 said:
    Ok lang po ba kung kahit saang law office magpagawa nitong affidavit? or magpa notary? Salamat po ulit ma'am.

    Retype mo na lang tapos dalhin sa kahit sinong notaryo publico.

    ++++++++++++++++++++++++
    07.2016 | IELTS
    01.2017 | Applied to AHPRA
    04.2017 | received Letter of Referral
    09.2017 | finished BP
    11.2017 | AHPRA Registration / Employment Offer
    12.2017 | Lodged 457 Visa Application (onshore) / ANMAC Assessment
    01.2018 | 457 Visa granted / Received positive ANMAC Assessment / Submitted EOI

    04.11.2019 | Received Employer Nomination
    04.26.2019 | Submitted Visa application (186 DE)
    05.06.2019 | CO contact for medical exams
    05.09.2019 | Visa Granted (186 DE)

    17.09.2021 | Application for Citizenship
    21.03.2022 | Citizenship exam, interview and approval
    02.07.2022 | Citizenship Ceremony
    (Thank you Lord!!!)

    21.03.2023 | Citizenship interview, exam and approval of dependents
    ++++++++++++++++++++++++

  • lecialecia Posts: 1,841Member
    Joined: Nov 06, 2016

    @anikaarkin0915 said:
    Ok lang po ba kung kahit saang law office magpagawa nitong affidavit? or magpa notary? Salamat po ulit ma'am.

    Try nyo po muna mag provide ng PCC. Madami naman paraan para maka obtain nyan. Last resort na ang stat dec. Alam ng CO na kaya mong makakuha nyan, check and do further research po..

    Pag hindi satisfied si CO, mag ask ulit yan. Panibagong antayan po ulit yan. Why not call and check with consul of Saudi in the Phils. My opinion.

    "For I know the plans I have for you, declares the Lord, "plans to prosper you and not to harm you, plans to give you hope and a future"

    Age: 25 Language: 20 Experience: 15 Education: 15

    08/09/2017 - passed Australian Medical Scientist exam
    27/10/2017 - PTE LRSW- 77/80/75/85
    2018- got promoted, new job responsibilities,stop muna ang AUSSIE DREAM
    25/09/2018- PTE LRSW- 70/82/90/70 ( technical, ayaw magmove ng mouse ko sa listening, 2 WFD diko nasagot, submitted report\complain pero wala din)
    17/10/2018- PTE LRSW- 84/77/90/84
    09/02/2019- PTE LRSW- 83/82/90/85
    10/02/2019 -EOI lodge 75 (189) 80 (190)
    11/02/2019 - ITA received 189 ( 75 points)
    12/02/2019 - NSW ITA received 190 ( 80 points)
    19/02/2019 - SG PCC released
    20/02/2019 - Medical at SATA Ang Mo Kio @6-9 pm night clinic
    23/02/2019 - Visa lodged 189
    06/03/2019 - NBI provided ( umuwi ako Pinas kasi sa online Last name ni husband nag aapear, di pa ako nagchange ng married name ko kaya gusto ko kapareho nun passport at iba pang docs ko. Pag sa Pinas, pinakita ko lang passport ko at yun nirelease nila.

  • lecialecia Posts: 1,841Member
    Joined: Nov 06, 2016

    Batch @tmasuncion pakihelp natin si @anikaarkin0915 . Diko mahanap ang thread ng middle east group. Pakitag nga po sya doon, para sa Saudi PCC.. salamat batchmate!

    "For I know the plans I have for you, declares the Lord, "plans to prosper you and not to harm you, plans to give you hope and a future"

    Age: 25 Language: 20 Experience: 15 Education: 15

    08/09/2017 - passed Australian Medical Scientist exam
    27/10/2017 - PTE LRSW- 77/80/75/85
    2018- got promoted, new job responsibilities,stop muna ang AUSSIE DREAM
    25/09/2018- PTE LRSW- 70/82/90/70 ( technical, ayaw magmove ng mouse ko sa listening, 2 WFD diko nasagot, submitted report\complain pero wala din)
    17/10/2018- PTE LRSW- 84/77/90/84
    09/02/2019- PTE LRSW- 83/82/90/85
    10/02/2019 -EOI lodge 75 (189) 80 (190)
    11/02/2019 - ITA received 189 ( 75 points)
    12/02/2019 - NSW ITA received 190 ( 80 points)
    19/02/2019 - SG PCC released
    20/02/2019 - Medical at SATA Ang Mo Kio @6-9 pm night clinic
    23/02/2019 - Visa lodged 189
    06/03/2019 - NBI provided ( umuwi ako Pinas kasi sa online Last name ni husband nag aapear, di pa ako nagchange ng married name ko kaya gusto ko kapareho nun passport at iba pang docs ko. Pag sa Pinas, pinakita ko lang passport ko at yun nirelease nila.

  • tmasunciontmasuncion Dubai
    Posts: 329Member
    Joined: Aug 04, 2017

    @lecia batchmate. di ko rin ma kita eh. wala atang Saudi na discussion sa forum. meron mga taga UAE. pero iba naman po ang UAE at Saudi.

    @anikaarkin0915 ang ma suggest ko eto. mag request ka online sa webisite ng Police Deprtment sa Saudi.
    a bit similar yung case natin pero sa akin naman, sa Singapore. luckily yung singapore police may website sila . so, doon na ako nag request. na try mo na ba?

    check mo to oh.
    http://geniusattestation.com/saudi-police-clearance-certificate.php?gclid=CjwKCAiA4Y7yBRB8EiwADV1haSr6-dOUU0c2xe7AJ4Q7KN_KwdNNSWHReC5hfq49frtG-bRgJrlHIhoC84wQAvD_BwE

    ANZCO COD: 263111 || Computer Network and Systems Engineer
    12.18.2015 || Signed up with a migration agent. Tried DIY to no avail! LOL!
    00.00.0000 || Contemplating for the entire 2016, some miscommunication between my agent as well. Luckily I made it still!
    08.26.2017 || Received Skills Assessment Results from ACS. Praise the Lord!
    06.06.2018 || PTE first attempt: L:81 R: 77 Speaking: 90 W: 82 (2 Points more for Reading! need a superior score, SMH)
    06.12.2018 || PTE 2nd attempt: L:86 R:87 S: 80 W: 79 (Finally got my desired score! Superior! Praises to God!)
    06.25.2018 || Submitted EOI for Visa 189 and 190 NSW (Felt good to submit EOI, little did I know it was just the beginning...)
    12.11.2018 || To God the Glory! Received Visa 189 ITA! Got teary-eyed on this day! called my mom in the Philippines!
    12.18.2018 || Received Wife's Dubai Police Clearance.
    01.12.2019 || Received my Dubai Police Clearance.
    01.14.2019 || Received my SG Police Clearance! worked here between from 2010 to 2011.
    01.16.2019 || Received NBI Clearance from the Philippines. (This took around 2 weeks)
    02.04.2019 || Lodge visa 189 Application!
    02.05 2019 || Schedule the Medical Examination.
    12.17.2019 || Best Christmas gift ever! The day we got our Grant! All the glory and praises to Him!
    04.01.2020 || Initial Entry (Tentative Date)
    07.20.2020 || Big Move Day! (Got out of Quarantine after 14 days)
    09.22.2020 || Got an Offer Letter (1st Job)
    09.13.2021 || Offer Letter (2nd Job) God is good! All the time!

    Jeremiah 29:11 For I know the plans I have for you, "declares the Lord," Plans to prosper you and not to harm you, plans to give you hope and a future.

  • tmasunciontmasuncion Dubai
    Posts: 329Member
    Joined: Aug 04, 2017

    eto may na basa ako oh. @anikaarkin0915 @lecia

    If the applicant is no longer residing in the Kingdom of Saudi Arabia:

     The applicant must designate a representative residing in Saudi Arabia who will transact with the Embassy and the Saudi authorities regarding the applicant’s Saudi police clearance. The Embassy will only entertain or provide related services regarding applications for Saudi police clearance with the presence of a designated representative of the applicant, who will personally transact with the Embassy and the Saudi authorities.
      The applicant must send to his designated representative, not to the Embassy, the following:
      A letter authorizing the designated representative to transact on behalf of the applicant;
      Duly-accomplished fingerprint card (with prints of all fingers) obtained through the relevant police authority of the country where the applicant is presently residing. If the applicant is in the Philippines, he or she should get a fingerprint card from the National Bureau of Investigation (NBI) or the Philippine National Police (PNP);
      Photocopy of passport used while applicant was resident in Saudi Arabia clearly showing the applicant’s photo/data page and all issued visas;
      Copy of applicant’s Saudi residence permit (iqama);
      Two (2) recently-taken 2” x 2” colored pictures with white background; and,
      Other relevant documents, if any, to support the application for police clearance.
      Fees:
      Notarial fee of SAR 100.00 for the Embassy’s “Seen and Noted” stamp on the fingerprint card.
      Authentication fee of SAR 30.00 for Saudi Ministry of Foreign Affairs’ authentication service.
    

    https://canberrape.dfa.gov.ph/guidelines-on-applying-for-saudi-police-clearance-from-australia

    ANZCO COD: 263111 || Computer Network and Systems Engineer
    12.18.2015 || Signed up with a migration agent. Tried DIY to no avail! LOL!
    00.00.0000 || Contemplating for the entire 2016, some miscommunication between my agent as well. Luckily I made it still!
    08.26.2017 || Received Skills Assessment Results from ACS. Praise the Lord!
    06.06.2018 || PTE first attempt: L:81 R: 77 Speaking: 90 W: 82 (2 Points more for Reading! need a superior score, SMH)
    06.12.2018 || PTE 2nd attempt: L:86 R:87 S: 80 W: 79 (Finally got my desired score! Superior! Praises to God!)
    06.25.2018 || Submitted EOI for Visa 189 and 190 NSW (Felt good to submit EOI, little did I know it was just the beginning...)
    12.11.2018 || To God the Glory! Received Visa 189 ITA! Got teary-eyed on this day! called my mom in the Philippines!
    12.18.2018 || Received Wife's Dubai Police Clearance.
    01.12.2019 || Received my Dubai Police Clearance.
    01.14.2019 || Received my SG Police Clearance! worked here between from 2010 to 2011.
    01.16.2019 || Received NBI Clearance from the Philippines. (This took around 2 weeks)
    02.04.2019 || Lodge visa 189 Application!
    02.05 2019 || Schedule the Medical Examination.
    12.17.2019 || Best Christmas gift ever! The day we got our Grant! All the glory and praises to Him!
    04.01.2020 || Initial Entry (Tentative Date)
    07.20.2020 || Big Move Day! (Got out of Quarantine after 14 days)
    09.22.2020 || Got an Offer Letter (1st Job)
    09.13.2021 || Offer Letter (2nd Job) God is good! All the time!

    Jeremiah 29:11 For I know the plans I have for you, "declares the Lord," Plans to prosper you and not to harm you, plans to give you hope and a future.

  • anikaarkin0915anikaarkin0915 Philippines
    Posts: 22Member
    Joined: Mar 27, 2019

    Thank you po sainyong lahat napakalaking tulog nito sa amin. Ang problem po ng wife ko wala na siyang pwedeng mapakiusapan na pwedeng mag represent sakanya sa Saudi. Isa pa po yung iqama nya or residence permit ID ay wala na rin sayang kahit photocopy. Salamat po ulit mga kabayan sa help.

    tmasuncion
  • lecialecia Posts: 1,841Member
    Joined: Nov 06, 2016

    @anikaarkin0915 youre welcome.. @tmasuncion thanks batch!!! All the best sa ating lahat..

    tmasuncion

    "For I know the plans I have for you, declares the Lord, "plans to prosper you and not to harm you, plans to give you hope and a future"

    Age: 25 Language: 20 Experience: 15 Education: 15

    08/09/2017 - passed Australian Medical Scientist exam
    27/10/2017 - PTE LRSW- 77/80/75/85
    2018- got promoted, new job responsibilities,stop muna ang AUSSIE DREAM
    25/09/2018- PTE LRSW- 70/82/90/70 ( technical, ayaw magmove ng mouse ko sa listening, 2 WFD diko nasagot, submitted report\complain pero wala din)
    17/10/2018- PTE LRSW- 84/77/90/84
    09/02/2019- PTE LRSW- 83/82/90/85
    10/02/2019 -EOI lodge 75 (189) 80 (190)
    11/02/2019 - ITA received 189 ( 75 points)
    12/02/2019 - NSW ITA received 190 ( 80 points)
    19/02/2019 - SG PCC released
    20/02/2019 - Medical at SATA Ang Mo Kio @6-9 pm night clinic
    23/02/2019 - Visa lodged 189
    06/03/2019 - NBI provided ( umuwi ako Pinas kasi sa online Last name ni husband nag aapear, di pa ako nagchange ng married name ko kaya gusto ko kapareho nun passport at iba pang docs ko. Pag sa Pinas, pinakita ko lang passport ko at yun nirelease nila.

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

kingisfromphhael17moonytrxmaikzxperezjecillevmalicdempayterwynpayterwyn_007kimpz0701HowardElerbjayallenb_sydneykbadmdabortizchlorineaubreygamuedacarlitooocooljudgesorianokotenlazuela
Browse Members

Members Online (0) + Guest (161)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌