Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

BIG MOVE 2019

1246756

Comments

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @ojde Yup expecting to be receiving some as there are companies who would prefer local experience. Just praying that one company will notice my skills and qualifications. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @milktea13 apply lang ng apply. We’ll land a job soon. Have faith. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • ojdeojde Australia
    Posts: 35Member
    Joined: May 26, 2018
    @chococrinkle agree. Just move on and carry positive mindset all the time!

    ANZSCO 312199 | Architectural, Building and Surveying Technicians nec | Total Points 75 | Visa type 489 (QLD)

    2017-May-24 | IELTS result received
    2018-Aug-07 | VETASSESS outcome received
    2018-Aug-25 | EOI lodged
    2018-Oct-18 | BSMQ invitation received
    2018-Nov-07 | Visa lodged (front loading My Health Declarations and SPF COC)
    2019-Jan-25 | CO (Adelaide) requested for dependent's PCC from country of origin
    2019-Feb-18 | Visa granted. IED 2019-Nov-07

  • lilithlilith Philippines
    Posts: 63Member
    Joined: Dec 15, 2017
    @caienri @chococrinkle strict ba cebupac magpasok fastfood from sa plane? kasi di kmi kumuha onboard meals pati sa 3 yr old namin. balak ksi namin bili na lang sa airport ng baon sa flight hehe.
  • jon1101ajon1101a Baguio City, Philippines
    Posts: 88Member
    Joined: Mar 24, 2017
    @zach@052019 gusto ko nga rin po sana i-avail yung 10k na cebupac na 10am ang dating kaso di ko pa nasabi sa susundo sakin eh

    233914 - Engineering Technologist | Age: 30 pts | Education:15 pts | Experience : 5 pts | English:20 pts | Total:75 pts.

    01.12.17 - PTE take 1
    02.12.17 - PTE result competent : L-76, R-76, S-88, W-84 : 10 pts claimed
    02.13.17 - Updated EOI to VISA 189/190(NSW) (60/65)
    15.02.18 - PTE take 2
    16.02.18 - PTE result superior: L-79, R-80, S-90, W-79 : 20 pts claimed.
    17.02.18 - Updated EOI to VISA 189/190(NSW-VIC) (70/75)
    14.05.18 - Work experience milestone. 5 years
    Updated EOI to VISA 189/190(NSW-VIC) (75/80)
    11.08.18 - Invitation Received EOI 189. Finally. :D
    20.08.18 - 189 VISA lodge
    22.08.18 - Medicals at Nationwide
    07.11.18 - DIRECT GRANT after 80 days. :D

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @lilith if its a meal its okay with them. Drinks lang ang bawal. Its a general rule kasi before pumasok sa immigration pinapa consume/dispose na ang drinks. Kahit may bata bawal talaga unless nakalagay sa feeding bottles, pero minimal amount lang. We were able to bring in burgers, fries and sundae.

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • milktea13milktea13 Philippines
    Posts: 294Member
    Joined: Jun 26, 2018
  • lilithlilith Philippines
    Posts: 63Member
    Joined: Dec 15, 2017
  • milktea13milktea13 Philippines
    Posts: 294Member
    Joined: Jun 26, 2018
    Hi!

    May nagdownloAd and print ba nung Australia Incoming Passenger Card? May link kau?
  • caienricaienri Sydney
    Posts: 212Member
    Joined: Jul 17, 2016
    @lilith nasagot na ang tanong. Hehe

    Btw, andito na po ako sa Sydney. Yung mga declared items ko hnd nmn binusisi. Nagtanong lang if nilinis ko yunh shoes, sabi ko lang oo, then okay na. Mabusisi lang talaga sila sa food.

    Nagtaxi ako 13cabs inabot ng $116 from international airport to Toongabbie. Malayo and nataon na Australia Day ang dating ko kaya mahal and mas mahal ang uber, $125. Sa SG mahal na ang $30. Lol Difo pede ng plane ticket yung pinantaxi ko. Hehe
    Madami akong dala kaya okay na lang din.

    Anyway happy to be here finally :)
  • mxv588tmxv588t Sydney
    Posts: 209Member
    Joined: Jul 28, 2014
    Wow. Ako IE from 1-6 Feb. Mag asikaso na rin ng bank (CBA ako and madali rin magtransfer from POSB to CBA). Asikasuhin ko na rin yung TFN habang nandun.

    May meet-up ako sa Senior talent acquisition advisor and Regional Manager ng company namin sa AUS branch. Sana may work opportunity.

    Then pasyal sa weekends.

    149913 Facilities Manager (Age Pts:30 | English: 20 | Education: 15 | Experience: 0 | State Nomination: 5 | Total 70 pts)

    11 Oct 2016 - Engaged services of a migration agent
    20 Jan 2017 - VETASSESS Submission
    17 Mar 2017 - IELTS Results [L-7.5; R-8.5; W-7; S-7.5; OBS-7.5]
    13 Apr 2017 - VETASSESS negative assessment
    5 Jun 2017 - VETASSESS reassessment
    4 Dec 2017 - Positive Outcome (1 year only)
    19 Dec 2017 - PTE Results [L - 90; R - 80; W - 88; S - 90; Overall 87)
    20 Dec 2017 - Submitted EOI to NSW under stream 2.
    16 Mar 2018 - NSW Pre invite
    19 Mar 2018 - Submitted application for NSW Nomination
    18 May 2018 - DIBP Invite to lodge VISA / Approval for NSW Nomination
    19 Jun 2018 - Lodged VISA
    26 Jun 2018 - wife and son medical checks (@ St. Lukes Global)
    29 Jun 2018 - SG Police COC fingerprinting (mine)
    30 Jun 2018 - medical checks at Point Medical (mine)
    13 Jul 2018 - SG Police COC fingerprinting (wife)
    9 Aug 2018 - NBI clearance (me and wife)
    8 Oct 2018 - CO contact - GSM Adelaide - requesting for Evidence of Superior English: assign PTE scores
    10 Dec 2018 - VISA granted! Thank you Lord!
    1 Feb 2019 - Initial Entry
    2 May 2019 - BM
    3 May 2019 - Started work
    15 Jun 2019 - wife and son BM
    15 Jun 2023 - lodged citizenship application
    5 Jul 2023 - received schedule for exam
    14 Aug 2023 - Exam
    21 Aug 2023 - Citizenship approved!
    31 Oct 2023 - Citizenship ceremony

  • GrifterGrifter Posts: 458Member
    Joined: Oct 19, 2016
    @mxv588t batchmate! :D ie din kame ng april, bm by next yr pa. kelan ka bm? nalito naman Kse ko kung need pa ba kumuha ng tfn kung matagal pa mag bm?
  • mxv588tmxv588t Sydney
    Posts: 209Member
    Joined: Jul 28, 2014
    @Grifter batchmate! Baka mauna ako mag BM ng May this year para makasettle muna bago sumunod wife and son ko (28 Jun dapat maka BM na). Need ko pa magresign dito sa SG pagkakuha ng bonus ng end of March hehe. Actually, kahit pag BM mo na ikaw kumuha ng TFN. Ako kasi gagamitin ko lang yung address ng friend ko.

    149913 Facilities Manager (Age Pts:30 | English: 20 | Education: 15 | Experience: 0 | State Nomination: 5 | Total 70 pts)

    11 Oct 2016 - Engaged services of a migration agent
    20 Jan 2017 - VETASSESS Submission
    17 Mar 2017 - IELTS Results [L-7.5; R-8.5; W-7; S-7.5; OBS-7.5]
    13 Apr 2017 - VETASSESS negative assessment
    5 Jun 2017 - VETASSESS reassessment
    4 Dec 2017 - Positive Outcome (1 year only)
    19 Dec 2017 - PTE Results [L - 90; R - 80; W - 88; S - 90; Overall 87)
    20 Dec 2017 - Submitted EOI to NSW under stream 2.
    16 Mar 2018 - NSW Pre invite
    19 Mar 2018 - Submitted application for NSW Nomination
    18 May 2018 - DIBP Invite to lodge VISA / Approval for NSW Nomination
    19 Jun 2018 - Lodged VISA
    26 Jun 2018 - wife and son medical checks (@ St. Lukes Global)
    29 Jun 2018 - SG Police COC fingerprinting (mine)
    30 Jun 2018 - medical checks at Point Medical (mine)
    13 Jul 2018 - SG Police COC fingerprinting (wife)
    9 Aug 2018 - NBI clearance (me and wife)
    8 Oct 2018 - CO contact - GSM Adelaide - requesting for Evidence of Superior English: assign PTE scores
    10 Dec 2018 - VISA granted! Thank you Lord!
    1 Feb 2019 - Initial Entry
    2 May 2019 - BM
    3 May 2019 - Started work
    15 Jun 2019 - wife and son BM
    15 Jun 2023 - lodged citizenship application
    5 Jul 2023 - received schedule for exam
    14 Aug 2023 - Exam
    21 Aug 2023 - Citizenship approved!
    31 Oct 2023 - Citizenship ceremony

  • HendroHendro SG
    Posts: 472Member
    Joined: Mar 31, 2018
    Possible ba mag ayos ng medicare, centrelink sa adelaide during Initial entry pero ang address na ggagamitin ay sa melbourne, para dun maipadla ung mga cards?

    ANZSCO 311411 | Age :30, Education: 15, Experience: 10, PTE: 10|

    04.04.2018 | Lodged Vetassess Assessment
    05.31.2018 | Vetassess Result : POSITIVE
    06.18.2018 | PTE Mock Test A |LRSW|65/69/79/68|
    06.23.2018 | PTE Mock Test B |LRSW|74/65/84/76|
    06.28.2018 | PTE-A |LRSW|74/73/90/74|
    07.06.2018 | Submitted 190 EOI 65+5=70 pts SA|
    07.08.2018 | Lodged SA State Nomination Application
    10.03.2018 | 190 Invitation Received.
    10.12.2018 | Singapore COC issued
    11.06.2018 | NBI Clearance Issued
    11.17.2018 | Medicals (Point Medical Paragon)
    11.23.2018 | Health Clearance Provided - No Actions Required
    11.23.2018 | Visa Lodgement
    03.04.2019 | Direct Grant! Thank you LORD!
    04.18.2019 | IED | Adelaide
    03.18.2021 | BM | Adelaide

    | Set your goals high, and don't stop till you get there.|

  • CapitolCapitol Posts: 9Member
    Joined: Jan 21, 2019
    Hello! IE and BM na rin at the same time ko sa May, then sunod si wife sa August. Hopefully makahanap agad ako ng work bago sya dumating. I’ve been backreading and Posts here are very informative and helpful! Thank you! I’ll try and contribute rin as much as I can. God bless us all in this adventure :)

    ANZSCO 261313 | Software Engineer | 189 | Total points = 80

    03.09.2017 | Lodged ACS Assessnent
    03.21.2017 | Received ACS Assessment
    07.30.2018 | PTE A Test: LRSW | 88/90/90/86
    09.04.2018 | Lodged EOI 189 (80 pts)
    09.11.2018 | ITA Received 189
    10.21.2018 | Lodged Visa (189)
    01.02.2019 | Direct Visa Grant!!
    05.26.2019 | Big Move to Sydney!!!!

  • fruitysfruitys Brisbane
    Posts: 83Member
    Joined: Apr 13, 2018
    @Hendro The forms only ask for the postal address. Just let Medicare know when you submit the form since you'll need to show up to a service centre anyway.

    SI 189 - Software Engineer - 261313 (80 pts)

    -- offshore --
    11-Oct-2017 - ACS (ICT major, 8+ years)
    18-Oct-2017 - PTE (90)
    19-Oct-2017 - EOI
    09-Nov-2017 - Invited
    06-Feb-2018 - Grant
    13-Feb-2018 - PDOS
    -- onshore --
    02-Jun-2018 - Initial entry
    04-Jun-2018 - TFN, Medicare, MyGov
    05-Jun-2018 - Start job hunting
    25-Jun-2018 - Driver licence
    26-Jul-2018 - Opened super
    30-Jul-2018 - Job 1 start - permie - $
    12-Feb-2021 - Job 1 end (redundancy)
    22-Feb-2021 - Job 2 start - contract - $$$

  • rjlimrjlim Sydney
    Posts: 127Member
    Joined: Nov 26, 2018
    @caienri hello kamusta ang BM mo? Hope all went well.

    Jul 15 2017 | Desire to migrate to AU initiated
    Aug 17 2017 | Inquired at migration assistance but fee was too high
    Aug 30 2017 | Invoked a freelance migration agent
    Sep 20 2017 | ACS assessment request
    Nov 15 2017 | ACS results positive
    Dec 11 2017 | PTE review course taken
    Jan 08 2018 | PTE take (L-80 | R-73 | S-84 | W-82) (Proficient)
    Jan 09 2018 | EOI lodge 189 | 65 | 263111 Computer Network and Systems Engineer
    Apr 23 2018 | PTE Retake. (L-80 | R-80 | S-83 | W-78) (Proficient)
    May 23 2018 | PTE Retake. (L-82 | R-79 | S-85 | W-83) (Superior)
    May 24 2018 | Updated EOI 189 | 75 | 263111 Computer Network and Systems Engineer
    Jul 02 2018 | Points reduced to 70 because of age
    Jul 02 2018 | Updated EOI 189 | 70 | 263111 Computer Network and Systems Engineer
    Nov 11 2018 | 189 Invite THANK YOU LORD!
    Nov 17 2018 | Medical exam
    Dec 04 2018 | Visa lodge
    Mar 19 2019 | Visa DG! To God Be The Glory! God is good all the time! All the time God is good!
    between the dates are a lot of requirements gathering and praying
    July 25 2019 | Touchdown Sydney!
    July 26 2019 | Medicare and ATO
    July 29 2019 | Job hunting and house hunting
    Aug 8 2019 | Move in new house
    Sept 26 2019 | started First job! Praise the Lord
    Oct 24 2019 | resigned from 1st job
    Oct 28 2019 | started second job aligned with my skills and previous experience
    Dec 22 2020 | logged child visa 101
    Feb 19 2021 | AFP and Medical Request
    May 05 2021 | Child Visa 101 approved

  • barbedwirebarbedwire Malaysia
    Posts: 45Member
    Joined: Apr 04, 2016
    @Capitol Good luck sa IE at BM! Balitaan mo kami!

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 10pts | English: 20pts | Total: 75pts

    04.2016 - joined pinoyau forum
    21.03.2017 - visited AU at naconvince na seryosohin na ang pagaapply
    19.08.2017 - Received ACS assessment: AQF Bachelor Degree, 2 years deducted
    23.06.2018 | PTE Mock Test B |LRSW|80/71/59/87|
    05.07.2018 | PTE-A |LRSW|90/84/90/89|
    10.07.2018 - Submitted EOI 189/190 (VIC) (75/80)
    11.08.2018 - ITA Received
    30.09.2018 - Visa Lodged
    10.12.2018 - Direct Grant! Thank you Lord!
    04.05.2019 - IE in Melbourne
    06.2019 - Job Offer in SA! Thank you ulit Lord!
    13.07.2019 - BM in Adelaide

  • caienricaienri Sydney
    Posts: 212Member
    Joined: Jul 17, 2016
    @rjlim so far okay naman. Holiday pa today so hindi pa ako makapag ayos ng medicare/centrelink etc.
    Busy sa pag grocery hehe
    Yesterday since Sunday nakapag ikot ako sa mall, sa westfied, nag scout ng mga murang gamit sa bahay na kelangan like pillows, toiletries etc. Mura and maganda rin nmn sa kmart. Nag compare ng prices, mejo same din sa sg yung mga shoes, damit basta hnd ka maxado tumitingin sa brand.
    Yung grocery nmn sa woollies kasi nasa baba lang ng bahay namin. So far yun pa lang naman.
  • caienricaienri Sydney
    Posts: 212Member
    Joined: Jul 17, 2016
    Update!
    Went to Parramatta where the service centre and medicare are just two blocks away from each other. All done in two hours.
    1. TFN was applied online
    2. Working With Children Check
    - go to the service centre with your passport, atm card, and pay $80
    - WWCC number will be emailed after 2-3 working days
    3. Medicare
    - go to medicare/centrelink office with your passport, grant letter, and application form
    - After they encode your details and make a copy of your passport and grant letter, they will give you a temporary ID (A4 paper)
    4. Centrelink
    - No need for single individuals
  • agdagd Singapore
    Posts: 773Member
    Joined: Jun 12, 2017

    @agd @caienri gaano katagal para mareceive sa NAB yun transfer sa DBS or POSB? Nagtransfer na kasi ako. Salamat.

    sorry, super late reply na. hehe. next working day namin nareceive. :) Pag nagsend ka ng morning, 12am next day nasa NAB na sya :)

    261312 Developer Programmer - (English - 20pts | Age - 30pts. | Qualification - 10 | Experience - 0 ) = 60pts.

    Subclass 189 - 60pts.
    Subclass 190 - (60 + 5 spouse points + 5 SN) = 70pts.

    08/04/2016 - Took IELTS - L/R/W/S - 6.5/7/6.5/7 - Competent
    05/17/2017 - PTE Mock A - L/R/W/S - 74/62/66/76
    05/19/2017 - PTE Mock B - L/R/W/S - 76/70/72/89
    05/30/2017 - PTE Take 1 - L/R/W/S - 79/75/78/78 - Proficient
    06/06/2017 - PTE Take 2 - L/R/W/S - 82/87/90/88- Superior - Thank you, Lord! :)

    PTE Tips: http://pinoyau.info/discussion/4233/pte-academic/p465#Comment_245887

    06/14/2017 - Collection of docs for ACS Assessment
    06/21/2017 - Submitted ACS Assessment
    08/14/2017 - ACS Result Positive. Equivalent to AQF Associate Degree. 5 years experience deducted.
    08/15/2017 - Gathering docs for spouse points (VETASSESS)
    08/22/2017 - Lodged spouse's VETASSESS
    10/05/2017 - VETASSESS results positive - aquired 5pts. for 190
    10/07/2017 - Submitted EOI - 189, 190-NSW, 190-VIC
    10/20/2017 - ITA NSW Received!
    10/22/2017 - Submitted NSW Application
    11/28/2017 - NSW SS Approved! Received ITA for visa 190

    ---------------Gathering docs for visa lodge---------------

    -------------------- Christmas Break --------------------

    01-19-2018 - Visa lodge, SG eAppeal
    01-23-2018 - SG eAppeal Approved
    01-25-2018 - Wife's SG eAppeal Approved
    02-03-2018 - Medical - wife and me
    02-05-2018 - Medical - kids
    02-08-2018 - Medical - Daughter - IGRA
    02-14-2018 - Form 815 Health Undertaking for daughter
    04-27-2018 - 1st CO Contact: Parental Consent/Form 1229
    05-22-2018 - 2nd CO Contact: Wife's Statutory Declaration
    08-21-2018 - 3rd CO Contact: Repeat Medical - Daughter
    09-21-2018 - VISA GRANT! Thank you Lord!

    11-11-2018 - IE (Medicare, Centrelink, NSW DL)
    April 2019 - Target BM with wife
    January 2020 - Target BM - 3 kids

  • milktea13milktea13 Philippines
    Posts: 294Member
    Joined: Jun 26, 2018
    @caienri hi! Ung TFN naapply mo before ka dunating aus? Tnx!
  • caienricaienri Sydney
    Posts: 212Member
    Joined: Jul 17, 2016
    @milktea13 hindi eh. Nung dumating na ako.
  • flaming_vinesflaming_vines Sydney
    Posts: 58Member
    Joined: Nov 15, 2018
    @agd @caienri salamat. pumasok naman din un transfer ko natagalan lang kasi holiday pala kahapon sa AU.
    @caienri musta naman ang vibe dyan compare to SG? Nababasa ko un Parramatta crowded daw? Pero baka naman iba pa rin ang crowded ng SG? hehe

    Visa 189 Grant Dec 3, 2018

  • caienricaienri Sydney
    Posts: 212Member
    Joined: Jul 17, 2016
    @flaming_vines iba pa rin ang crowded ng sg (city hall mrt) mejo chill pa sa parramatta pero city vibe din. Mas mabilis maglakad ang mga taga sg. Hehe
  • agdagd Singapore
    Posts: 773Member
    Joined: Jun 12, 2017
    @flaming_vines inabutan kami ng rush hour uwian sa CBD, sobrang daming tao talaga, parang SG din. :D

    261312 Developer Programmer - (English - 20pts | Age - 30pts. | Qualification - 10 | Experience - 0 ) = 60pts.

    Subclass 189 - 60pts.
    Subclass 190 - (60 + 5 spouse points + 5 SN) = 70pts.

    08/04/2016 - Took IELTS - L/R/W/S - 6.5/7/6.5/7 - Competent
    05/17/2017 - PTE Mock A - L/R/W/S - 74/62/66/76
    05/19/2017 - PTE Mock B - L/R/W/S - 76/70/72/89
    05/30/2017 - PTE Take 1 - L/R/W/S - 79/75/78/78 - Proficient
    06/06/2017 - PTE Take 2 - L/R/W/S - 82/87/90/88- Superior - Thank you, Lord! :)

    PTE Tips: http://pinoyau.info/discussion/4233/pte-academic/p465#Comment_245887

    06/14/2017 - Collection of docs for ACS Assessment
    06/21/2017 - Submitted ACS Assessment
    08/14/2017 - ACS Result Positive. Equivalent to AQF Associate Degree. 5 years experience deducted.
    08/15/2017 - Gathering docs for spouse points (VETASSESS)
    08/22/2017 - Lodged spouse's VETASSESS
    10/05/2017 - VETASSESS results positive - aquired 5pts. for 190
    10/07/2017 - Submitted EOI - 189, 190-NSW, 190-VIC
    10/20/2017 - ITA NSW Received!
    10/22/2017 - Submitted NSW Application
    11/28/2017 - NSW SS Approved! Received ITA for visa 190

    ---------------Gathering docs for visa lodge---------------

    -------------------- Christmas Break --------------------

    01-19-2018 - Visa lodge, SG eAppeal
    01-23-2018 - SG eAppeal Approved
    01-25-2018 - Wife's SG eAppeal Approved
    02-03-2018 - Medical - wife and me
    02-05-2018 - Medical - kids
    02-08-2018 - Medical - Daughter - IGRA
    02-14-2018 - Form 815 Health Undertaking for daughter
    04-27-2018 - 1st CO Contact: Parental Consent/Form 1229
    05-22-2018 - 2nd CO Contact: Wife's Statutory Declaration
    08-21-2018 - 3rd CO Contact: Repeat Medical - Daughter
    09-21-2018 - VISA GRANT! Thank you Lord!

    11-11-2018 - IE (Medicare, Centrelink, NSW DL)
    April 2019 - Target BM with wife
    January 2020 - Target BM - 3 kids

  • flaming_vinesflaming_vines Sydney
    Posts: 58Member
    Joined: Nov 15, 2018
    @caienri oo parang robot mga tao dito e. May escalator ruling din ba dyan na stand on left or right?
    @agd naku IE kame next month iwasan pala namen bumyahe ng Rush hour kasi may stroller kameng dala. baka parang SG inde makakapasok pag weekdays rush hour. hehe

    Visa 189 Grant Dec 3, 2018

  • agdagd Singapore
    Posts: 773Member
    Joined: Jun 12, 2017
    @flaming_vines may stroller kami actually nun, 3 kids namin then 2 yung strollers. May mga platform na di kalevel nung train kaya mejo bubuhatin mo pa ng konti. :)) Siguro yun lang din, iwas lang sa CBD pag rush hour.

    261312 Developer Programmer - (English - 20pts | Age - 30pts. | Qualification - 10 | Experience - 0 ) = 60pts.

    Subclass 189 - 60pts.
    Subclass 190 - (60 + 5 spouse points + 5 SN) = 70pts.

    08/04/2016 - Took IELTS - L/R/W/S - 6.5/7/6.5/7 - Competent
    05/17/2017 - PTE Mock A - L/R/W/S - 74/62/66/76
    05/19/2017 - PTE Mock B - L/R/W/S - 76/70/72/89
    05/30/2017 - PTE Take 1 - L/R/W/S - 79/75/78/78 - Proficient
    06/06/2017 - PTE Take 2 - L/R/W/S - 82/87/90/88- Superior - Thank you, Lord! :)

    PTE Tips: http://pinoyau.info/discussion/4233/pte-academic/p465#Comment_245887

    06/14/2017 - Collection of docs for ACS Assessment
    06/21/2017 - Submitted ACS Assessment
    08/14/2017 - ACS Result Positive. Equivalent to AQF Associate Degree. 5 years experience deducted.
    08/15/2017 - Gathering docs for spouse points (VETASSESS)
    08/22/2017 - Lodged spouse's VETASSESS
    10/05/2017 - VETASSESS results positive - aquired 5pts. for 190
    10/07/2017 - Submitted EOI - 189, 190-NSW, 190-VIC
    10/20/2017 - ITA NSW Received!
    10/22/2017 - Submitted NSW Application
    11/28/2017 - NSW SS Approved! Received ITA for visa 190

    ---------------Gathering docs for visa lodge---------------

    -------------------- Christmas Break --------------------

    01-19-2018 - Visa lodge, SG eAppeal
    01-23-2018 - SG eAppeal Approved
    01-25-2018 - Wife's SG eAppeal Approved
    02-03-2018 - Medical - wife and me
    02-05-2018 - Medical - kids
    02-08-2018 - Medical - Daughter - IGRA
    02-14-2018 - Form 815 Health Undertaking for daughter
    04-27-2018 - 1st CO Contact: Parental Consent/Form 1229
    05-22-2018 - 2nd CO Contact: Wife's Statutory Declaration
    08-21-2018 - 3rd CO Contact: Repeat Medical - Daughter
    09-21-2018 - VISA GRANT! Thank you Lord!

    11-11-2018 - IE (Medicare, Centrelink, NSW DL)
    April 2019 - Target BM with wife
    January 2020 - Target BM - 3 kids

  • RejNaix11RejNaix11 Philippines
    Posts: 71Member
    Joined: Apr 09, 2018
    Hi @caienri Ask ko lang para saan po yung WWCC?
  • flaming_vinesflaming_vines Sydney
    Posts: 58Member
    Joined: Nov 15, 2018
    @agd exercise yun sa inyo ha. Un mga kainan ba sa AU may mga baby chair naman? Baka kasi parang gaya ng Japan na napakahirap humanap ng resto o foodcrt na may baby chair. hehe

    Visa 189 Grant Dec 3, 2018

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

GeorgeLeeHezronrecardopinoisaudiboi8988iblessycardo suberiekxiaoluCORTESJAYJLEvaristonayabrayajpearlthefishthekneelawelynneislovelaurenceoliveralbaAybandanielTsiSenJuven1016rapsgalbertus1982arct
Browse Members

Members Online (0) + Guest (148)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌