Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

BIG MOVE 2019

1356756

Comments

  • caienricaienri Sydney
    Posts: 212Member
    Joined: Jul 17, 2016
    @flaming_vines
    3. Eftpos card ibibigay during the appointment. Tpos upon request yung card na may visa/mastercard na idedeliver sa address mo in Au.
  • agdagd Singapore
    Posts: 773Member
    Joined: Jun 12, 2017
    @flaming_vines hello!

    1. Pagdating ko dun, sabi ko magcocovert ako ng license. Hiningi sakin yung SG License, fillup ng form, present LTO Certificate(coloured copy), ATM card ng NAB Bank, and payment. Sila na mismo magpipicture sayo dun.

    2. Yes, kailangan mo ng address talaga. Pwede mo naman din i-update paglipat nyo, kung address sya ng friend mo. Snail mail lang. Yung samin, dumating after 8 days sa address ng friend, so di na namin nahabol. Sakto lang na umuwi yung friend namin, sya na nagdala sa pinas.

    3. Depende sa branch. Sa Manly kami kaya wala masyado tao so nabigay agad. Based sa mga nabasa ko, sa West Sydney areas daw minsan walang available kaagad, kaya snail mail talaga. eftpos yung card na default pero nagrequest kami ng visa kasi balak din namin gamitin overseas.

    4. Yes, iBanking. may mga OTP na din.

    No problem, tanong ka lang! :) FYI din, itago nyo yung mga boarding pass nyo. Tinanong sakin yan sa bank and sa Centrelink as proof na kakadating lang talaga ng AU.

    261312 Developer Programmer - (English - 20pts | Age - 30pts. | Qualification - 10 | Experience - 0 ) = 60pts.

    Subclass 189 - 60pts.
    Subclass 190 - (60 + 5 spouse points + 5 SN) = 70pts.

    08/04/2016 - Took IELTS - L/R/W/S - 6.5/7/6.5/7 - Competent
    05/17/2017 - PTE Mock A - L/R/W/S - 74/62/66/76
    05/19/2017 - PTE Mock B - L/R/W/S - 76/70/72/89
    05/30/2017 - PTE Take 1 - L/R/W/S - 79/75/78/78 - Proficient
    06/06/2017 - PTE Take 2 - L/R/W/S - 82/87/90/88- Superior - Thank you, Lord! :)

    PTE Tips: http://pinoyau.info/discussion/4233/pte-academic/p465#Comment_245887

    06/14/2017 - Collection of docs for ACS Assessment
    06/21/2017 - Submitted ACS Assessment
    08/14/2017 - ACS Result Positive. Equivalent to AQF Associate Degree. 5 years experience deducted.
    08/15/2017 - Gathering docs for spouse points (VETASSESS)
    08/22/2017 - Lodged spouse's VETASSESS
    10/05/2017 - VETASSESS results positive - aquired 5pts. for 190
    10/07/2017 - Submitted EOI - 189, 190-NSW, 190-VIC
    10/20/2017 - ITA NSW Received!
    10/22/2017 - Submitted NSW Application
    11/28/2017 - NSW SS Approved! Received ITA for visa 190

    ---------------Gathering docs for visa lodge---------------

    -------------------- Christmas Break --------------------

    01-19-2018 - Visa lodge, SG eAppeal
    01-23-2018 - SG eAppeal Approved
    01-25-2018 - Wife's SG eAppeal Approved
    02-03-2018 - Medical - wife and me
    02-05-2018 - Medical - kids
    02-08-2018 - Medical - Daughter - IGRA
    02-14-2018 - Form 815 Health Undertaking for daughter
    04-27-2018 - 1st CO Contact: Parental Consent/Form 1229
    05-22-2018 - 2nd CO Contact: Wife's Statutory Declaration
    08-21-2018 - 3rd CO Contact: Repeat Medical - Daughter
    09-21-2018 - VISA GRANT! Thank you Lord!

    11-11-2018 - IE (Medicare, Centrelink, NSW DL)
    April 2019 - Target BM with wife
    January 2020 - Target BM - 3 kids

  • flaming_vinesflaming_vines Sydney
    Posts: 58Member
    Joined: Nov 15, 2018
    @caienri salamat
    @agd uy very informative. Salamat. Last question un TFN at Medicare alam ko yun rason bakit inde advisablei apply sa IE at sa actual BM na lang. Pero un Centrlink may added advantage ba na i apply na sa IE? Kasi nababasa ko i-count naman nila yun days mo based dun sa actual na nandun ka at inde sa IE date mo.

    Visa 189 Grant Dec 3, 2018

  • agdagd Singapore
    Posts: 773Member
    Joined: Jun 12, 2017
    @flaming_vines Yung TFN, di pa naman inapply talaga kasi mejo mahaba yung gap na lalabas kami ng AU, pati wala pa din kaming work.

    Yung Medicare, ok lang sya i-apply agad kasi pwede mo na gamitin agad agad yun kahit wala pa yung physical card. :)

    Centrelink, yes, parang pareho tayo ng nabasa :)) Malalaman naman nila pag offshore or onshore ka.

    261312 Developer Programmer - (English - 20pts | Age - 30pts. | Qualification - 10 | Experience - 0 ) = 60pts.

    Subclass 189 - 60pts.
    Subclass 190 - (60 + 5 spouse points + 5 SN) = 70pts.

    08/04/2016 - Took IELTS - L/R/W/S - 6.5/7/6.5/7 - Competent
    05/17/2017 - PTE Mock A - L/R/W/S - 74/62/66/76
    05/19/2017 - PTE Mock B - L/R/W/S - 76/70/72/89
    05/30/2017 - PTE Take 1 - L/R/W/S - 79/75/78/78 - Proficient
    06/06/2017 - PTE Take 2 - L/R/W/S - 82/87/90/88- Superior - Thank you, Lord! :)

    PTE Tips: http://pinoyau.info/discussion/4233/pte-academic/p465#Comment_245887

    06/14/2017 - Collection of docs for ACS Assessment
    06/21/2017 - Submitted ACS Assessment
    08/14/2017 - ACS Result Positive. Equivalent to AQF Associate Degree. 5 years experience deducted.
    08/15/2017 - Gathering docs for spouse points (VETASSESS)
    08/22/2017 - Lodged spouse's VETASSESS
    10/05/2017 - VETASSESS results positive - aquired 5pts. for 190
    10/07/2017 - Submitted EOI - 189, 190-NSW, 190-VIC
    10/20/2017 - ITA NSW Received!
    10/22/2017 - Submitted NSW Application
    11/28/2017 - NSW SS Approved! Received ITA for visa 190

    ---------------Gathering docs for visa lodge---------------

    -------------------- Christmas Break --------------------

    01-19-2018 - Visa lodge, SG eAppeal
    01-23-2018 - SG eAppeal Approved
    01-25-2018 - Wife's SG eAppeal Approved
    02-03-2018 - Medical - wife and me
    02-05-2018 - Medical - kids
    02-08-2018 - Medical - Daughter - IGRA
    02-14-2018 - Form 815 Health Undertaking for daughter
    04-27-2018 - 1st CO Contact: Parental Consent/Form 1229
    05-22-2018 - 2nd CO Contact: Wife's Statutory Declaration
    08-21-2018 - 3rd CO Contact: Repeat Medical - Daughter
    09-21-2018 - VISA GRANT! Thank you Lord!

    11-11-2018 - IE (Medicare, Centrelink, NSW DL)
    April 2019 - Target BM with wife
    January 2020 - Target BM - 3 kids

  • flaming_vinesflaming_vines Sydney
    Posts: 58Member
    Joined: Nov 15, 2018
    @agd salamat ulit.yun tfn kasi nabasa ko na inde advisable kasi kailangan mo magdeclare ng income every end ng fiscal yr.although inde ka naman ma tax kaso hassle.hehe un medicare naman indr nila advice for people above 31 kasi un loading sa levy kun wala kang private insurance.kaya d ko iiapply muna. Kaya natanong ko yun centrlink kun ano advantage.hehe

    Visa 189 Grant Dec 3, 2018

  • gibo43gibo43 Morphett Vale, SA
    Posts: 318Member
    Joined: Oct 19, 2016
    @lilith sakin mabilis lang. Nagtransfer ako ng wed, Monday mismo nagreflect sa current balance ko.

    ANZSCO 233513 | Production or Plant Engineer | Age :25, Education: 15, Employment: 15, PTE: 20| Total points = 75

    10.01.2016 | Interest in OZ migration ignited!
    03.03.2018 | Started PTE review through CEVAS (10 sessions).
    05.15.2018 | PTE A Test : LRSW|79/86/83/86
    06.06.2018 | Lodged EA Assessment.
    08.28.2018 | Received positive results from EA (wew)! All experiences credited.
    08.28.2018 | Lodged EOI for visa 189.
    09.10.2018 | Invitation to Apply (ITA) received.
    09.27.2018 | Lodged visa.
    10.08.2018 | Medical for dependents (no action required).
    10.22.2018 | Medical for main applicant (no action required).
    12.17.2018 | IMMI Assessment Commence Letter Received.
    12.19.2018 | Grant finally! ^_^

  • barbedwirebarbedwire Malaysia
    Posts: 45Member
    Joined: Apr 04, 2016
    @zach@052019 ako po BM from Malaysia pero sa end of year pa. :D

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 10pts | English: 20pts | Total: 75pts

    04.2016 - joined pinoyau forum
    21.03.2017 - visited AU at naconvince na seryosohin na ang pagaapply
    19.08.2017 - Received ACS assessment: AQF Bachelor Degree, 2 years deducted
    23.06.2018 | PTE Mock Test B |LRSW|80/71/59/87|
    05.07.2018 | PTE-A |LRSW|90/84/90/89|
    10.07.2018 - Submitted EOI 189/190 (VIC) (75/80)
    11.08.2018 - ITA Received
    30.09.2018 - Visa Lodged
    10.12.2018 - Direct Grant! Thank you Lord!
    04.05.2019 - IE in Melbourne
    06.2019 - Job Offer in SA! Thank you ulit Lord!
    13.07.2019 - BM in Adelaide

  • lilithlilith Philippines
    Posts: 63Member
    Joined: Dec 15, 2017
    @gibo43 thanks! ksi next week na alis namin, kaya pag may aberya lagot hahaha :D
  • SGtoAUSGtoAU hervey Bay
    Posts: 215Member
    Joined: Feb 08, 2015
    @lilith update mo kame sa experience mo hehe good luck sa BM

    I am happy to help If you need a mortgage broker. Email - info@mortgagealley.com.au / www.mortgagealley.com.au

    ****Timeline
    Anszco Code: Construction Project Manager 133111
    28 Oct 17: IELTS test
    15 Apr 18: Skills Assessment Submitted (Vetassess)
    24 May 18: Positive Assessment received from Vetassess
    23 Jul 18: Lodged EOI for Subclass 489 QLD
    28 Aug 18: Received pre-invite from QLD
    04 Sep 18: Submitted all documents to QLD
    12 Sep 18: Received approval from QLD and invitation to apply
    17 Sep 18: Visa lodge
    22 Dec 18: Direct grant 12 Sep 18: Received approval from QLD and invitation to apply
    17 Sep 18: Visa lodge
    22 Dec 18: Direct grant
    01 Aug 2021: Applied for 887 visa
    Currently Waiting for PR grant

  • SGtoAUSGtoAU hervey Bay
    Posts: 215Member
    Joined: Feb 08, 2015
    @agd thanks po sa information! yan na lang din siguro open namen bank account since meron din kame dbss. multiple times na po kayo nag remit and ok naman?

    I am happy to help If you need a mortgage broker. Email - info@mortgagealley.com.au / www.mortgagealley.com.au

    ****Timeline
    Anszco Code: Construction Project Manager 133111
    28 Oct 17: IELTS test
    15 Apr 18: Skills Assessment Submitted (Vetassess)
    24 May 18: Positive Assessment received from Vetassess
    23 Jul 18: Lodged EOI for Subclass 489 QLD
    28 Aug 18: Received pre-invite from QLD
    04 Sep 18: Submitted all documents to QLD
    12 Sep 18: Received approval from QLD and invitation to apply
    17 Sep 18: Visa lodge
    22 Dec 18: Direct grant 12 Sep 18: Received approval from QLD and invitation to apply
    17 Sep 18: Visa lodge
    22 Dec 18: Direct grant
    01 Aug 2021: Applied for 887 visa
    Currently Waiting for PR grant

  • lilithlilith Philippines
    Posts: 63Member
    Joined: Dec 15, 2017
    @SGtoAU thanks! God bless din sa BM!

    in fairness nag transfer ako from bpi kahapon, nasa NAB na ngayon :)
  • agdagd Singapore
    Posts: 773Member
    Joined: Jun 12, 2017
    @SGtoAU twice palang! hehe. Yung una tinest ko lang muna, tas yung 2nd yun yung pandagdag sa IE budget. :D

    261312 Developer Programmer - (English - 20pts | Age - 30pts. | Qualification - 10 | Experience - 0 ) = 60pts.

    Subclass 189 - 60pts.
    Subclass 190 - (60 + 5 spouse points + 5 SN) = 70pts.

    08/04/2016 - Took IELTS - L/R/W/S - 6.5/7/6.5/7 - Competent
    05/17/2017 - PTE Mock A - L/R/W/S - 74/62/66/76
    05/19/2017 - PTE Mock B - L/R/W/S - 76/70/72/89
    05/30/2017 - PTE Take 1 - L/R/W/S - 79/75/78/78 - Proficient
    06/06/2017 - PTE Take 2 - L/R/W/S - 82/87/90/88- Superior - Thank you, Lord! :)

    PTE Tips: http://pinoyau.info/discussion/4233/pte-academic/p465#Comment_245887

    06/14/2017 - Collection of docs for ACS Assessment
    06/21/2017 - Submitted ACS Assessment
    08/14/2017 - ACS Result Positive. Equivalent to AQF Associate Degree. 5 years experience deducted.
    08/15/2017 - Gathering docs for spouse points (VETASSESS)
    08/22/2017 - Lodged spouse's VETASSESS
    10/05/2017 - VETASSESS results positive - aquired 5pts. for 190
    10/07/2017 - Submitted EOI - 189, 190-NSW, 190-VIC
    10/20/2017 - ITA NSW Received!
    10/22/2017 - Submitted NSW Application
    11/28/2017 - NSW SS Approved! Received ITA for visa 190

    ---------------Gathering docs for visa lodge---------------

    -------------------- Christmas Break --------------------

    01-19-2018 - Visa lodge, SG eAppeal
    01-23-2018 - SG eAppeal Approved
    01-25-2018 - Wife's SG eAppeal Approved
    02-03-2018 - Medical - wife and me
    02-05-2018 - Medical - kids
    02-08-2018 - Medical - Daughter - IGRA
    02-14-2018 - Form 815 Health Undertaking for daughter
    04-27-2018 - 1st CO Contact: Parental Consent/Form 1229
    05-22-2018 - 2nd CO Contact: Wife's Statutory Declaration
    08-21-2018 - 3rd CO Contact: Repeat Medical - Daughter
    09-21-2018 - VISA GRANT! Thank you Lord!

    11-11-2018 - IE (Medicare, Centrelink, NSW DL)
    April 2019 - Target BM with wife
    January 2020 - Target BM - 3 kids

  • jon1101ajon1101a Baguio City, Philippines
    Posts: 88Member
    Joined: Mar 24, 2017
    Hello guys! Big Move na rin ako sa Sydney this April 24 kaso di pa ako nakakabili ng ticket. Sa tingin nyo po ba worth it na yung 26000 php na PAL? one way lang

    233914 - Engineering Technologist | Age: 30 pts | Education:15 pts | Experience : 5 pts | English:20 pts | Total:75 pts.

    01.12.17 - PTE take 1
    02.12.17 - PTE result competent : L-76, R-76, S-88, W-84 : 10 pts claimed
    02.13.17 - Updated EOI to VISA 189/190(NSW) (60/65)
    15.02.18 - PTE take 2
    16.02.18 - PTE result superior: L-79, R-80, S-90, W-79 : 20 pts claimed.
    17.02.18 - Updated EOI to VISA 189/190(NSW-VIC) (70/75)
    14.05.18 - Work experience milestone. 5 years
    Updated EOI to VISA 189/190(NSW-VIC) (75/80)
    11.08.18 - Invitation Received EOI 189. Finally. :D
    20.08.18 - 189 VISA lodge
    22.08.18 - Medicals at Nationwide
    07.11.18 - DIRECT GRANT after 80 days. :D

  • zach@052019zach@052019 Melbourne
    Posts: 247Member
    Joined: Oct 22, 2018
    @jon1101a try mo via SG or KL. Kasi airasia from KL to SYD (one way promo) nasa 499RM = P6,200+. And from MNL to KL nasa less than P3,000 lang. Yun nga lang overlay ka pa ny ilang oras.

    Code

  • maryowni09maryowni09 Philippines
    Posts: 48Member
    Joined: Jun 02, 2018
    Kami ng misis ko 15k lng sa CEB. Kami n un n dalawa. With baggage and seat na.

    ANZSCO 233111| Chemical Engineer| Age :30, Education: 15, Employment: 10, PTE: 20

  • caienricaienri Sydney
    Posts: 212Member
    Joined: Jul 17, 2016
    20k nmn sakin with 40kg, meals, seat, travel tax sa CEBU Pac one way din.

    Sa Nab nmn nagtransfer aq from POSB every month na sweldo lalo n pag at least 1=1 exchange rate. Okay nmn for me para hnd q na nagagalaw pera ko s sg.
  • fufudoodsfufudoods singapore
    Posts: 29Member
    Joined: Oct 01, 2018
    @Heprex sa south east din kami ng melbourne and BM nanamin bukas. mag-airbnb muna kme for 2weeks. sa bandang mulgrave kami maghanap ng place para malapit sa hospital, don narin kasi ako manganganak. kamusta naman ang paligid diyan sa south-east?
  • jon1101ajon1101a Baguio City, Philippines
    Posts: 88Member
    Joined: Mar 24, 2017
    @zach@052019 Eto po kasi yung mga nakikita ko na flight sa April24 na date. Meron po yung mga mura kaso overnight layover naman. Avail ko na po ba yun?

    233914 - Engineering Technologist | Age: 30 pts | Education:15 pts | Experience : 5 pts | English:20 pts | Total:75 pts.

    01.12.17 - PTE take 1
    02.12.17 - PTE result competent : L-76, R-76, S-88, W-84 : 10 pts claimed
    02.13.17 - Updated EOI to VISA 189/190(NSW) (60/65)
    15.02.18 - PTE take 2
    16.02.18 - PTE result superior: L-79, R-80, S-90, W-79 : 20 pts claimed.
    17.02.18 - Updated EOI to VISA 189/190(NSW-VIC) (70/75)
    14.05.18 - Work experience milestone. 5 years
    Updated EOI to VISA 189/190(NSW-VIC) (75/80)
    11.08.18 - Invitation Received EOI 189. Finally. :D
    20.08.18 - 189 VISA lodge
    22.08.18 - Medicals at Nationwide
    07.11.18 - DIRECT GRANT after 80 days. :D

  • jon1101ajon1101a Baguio City, Philippines
    Posts: 88Member
    Joined: Mar 24, 2017
    @maryowni09 @caienri Need ko po kasi na hapon or evening sana darating para may susundo sakin. In-avail nyo po ba yung long layover?

    233914 - Engineering Technologist | Age: 30 pts | Education:15 pts | Experience : 5 pts | English:20 pts | Total:75 pts.

    01.12.17 - PTE take 1
    02.12.17 - PTE result competent : L-76, R-76, S-88, W-84 : 10 pts claimed
    02.13.17 - Updated EOI to VISA 189/190(NSW) (60/65)
    15.02.18 - PTE take 2
    16.02.18 - PTE result superior: L-79, R-80, S-90, W-79 : 20 pts claimed.
    17.02.18 - Updated EOI to VISA 189/190(NSW-VIC) (70/75)
    14.05.18 - Work experience milestone. 5 years
    Updated EOI to VISA 189/190(NSW-VIC) (75/80)
    11.08.18 - Invitation Received EOI 189. Finally. :D
    20.08.18 - 189 VISA lodge
    22.08.18 - Medicals at Nationwide
    07.11.18 - DIRECT GRANT after 80 days. :D

  • flaming_vinesflaming_vines Sydney
    Posts: 58Member
    Joined: Nov 15, 2018
    @agd @caienri gaano katagal para mareceive sa NAB yun transfer sa DBS or POSB? Nagtransfer na kasi ako. Salamat.

    Visa 189 Grant Dec 3, 2018

  • caienricaienri Sydney
    Posts: 212Member
    Joined: Jul 17, 2016
    edited January 2019
    @jon1101a hindi. Ang dami ko kasing dala and solo. So mas gusto ko direct na. Gabi din flight ko 11pm para tulog n lang sa plane. Dating ko dun mag uber lang or taxi and since sabado nmn, nasa bahay nmn yung mga tao sa titirhan ko. Ako kasi mas priority ko comfort khit mejo mahal. Eh kung mag taxi k n lng kesa yung mahal kunin mo i think pareho lang din. Pero nasa sayo yun. Pede ka din nmn muna tumambay sa airport
  • caienricaienri Sydney
    Posts: 212Member
    Joined: Jul 17, 2016
    edited January 2019
    @flaming_vines usually pag morning ako nag transfer, next day okay na. Working day ito ha.
  • zach@052019zach@052019 Melbourne
    Posts: 247Member
    Joined: Oct 22, 2018
    @jon1101a parang okay na ang promo ni CEBPAC, 10k+ arrival time 10 in the morning. Non stop naman.

    Code

  • caienricaienri Sydney
    Posts: 212Member
    Joined: Jul 17, 2016
    edited January 2019
    Checking in with Cebu Pacific
    Go to the airport earlier as each bag is being opened/inspected. At least 1 hour ako nakapila.
    Luggage protecter and locks medyo hassle kasi papabuksan nila.

    Sa check-in din tinanong if may i declare ako. Yung guitar tinanong din if electric or acoustic. Tapos sabi nila manual daw ikakarga so sana nga totoo. Dasal n lng.

    New rule for check in as of Jan 2019
    2 bags 20kg
    3 bags 32kg
    4 bags 40kg

    Pero yung sakin thankfully okay naman
    25kg - large luggage
    8kg - small luggage
    7kg - guitar in hard case
  • maryowni09maryowni09 Philippines
    Posts: 48Member
    Joined: Jun 02, 2018
    @jon1101a 6am flight namin. Ayaw ko may layover. Mapapagastos k pa hahaha kasi kung sa singapore baka matempt gumastos. Direct fligjht kami, 6pm dating. May mga nakausap n kami sa fb groups for accom. May nagoffer n sunduin kmi from airport to dun sa bahay n rerent nkin kasi xa ung nagpaparent

    ANZSCO 233111| Chemical Engineer| Age :30, Education: 15, Employment: 10, PTE: 20

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    edited January 2019
    Share ko din BM experience namin, me with 2 kids.

    Mla-Syd
    Peak season kaya madami tao. We had cebpac. Its better to be at the airport very early at least 5 to 6 hrs before the flight. I did not pay our travel tax when we booked kasi I have a 5 yo daughter and Ive read na may discount pag below 12 yo. 50% nalang yung travel tax nya. After paying the travel tax we proceeded sa check in. We had a total of 120 kilos, and ang tagal namin kasi binuksan isa isa ang bags (4 luggages and 2 boxes). Bawal din any liquid sa predep. Kahit yung 250ml na fresh milk in tetra pack ng anak ko bawal kaya pinainom ko nalang sa kanya before kami pumasok. Sa immigration, I had our visa print outs ready and the passports (old and new). Those who had their passports renewed after visa grant please bring your old passports just in case hanapin.

    When we arrived sydney airport mabilis lang sa immigration, I just presented our passports, once scanned they can see our visa so they didnt ask for the printout. We proceeded to customs as we declared some stuff (food, nuts, kitchen knives, wood item, otc meds). They are strict esp on fresh food. Yung food talaga chinicheck nila, I had ours contained in one hand carry bag kaya di na ako nagbukas ng maleta. They just asked what else did we bring, pero di naman pinabuksan. Its really best to just declare. Dont forget to clean your shoes kasi they will ask if you cleaned them. :-)

    Syd-Adl
    There’s a 4 dollar charge for use of trolley in sydney so make sure you have extra aud. We took jetstar and its a budget airline, they are very strict sa hand carry. They only allow a total of 7 kilos for hand carry per person (total for a hand bag and a small hand carry bag). Strict sila dito kasi sa pre dep before boarding the plane they will weigh each hand carry and they will charge extra if you exceed.

    Nab account
    I had mine opened in sydney but asked the bank teller to just mail my debit card in adelaide. The card arrived after 4 banking days

    TFN
    Registered online and received the TFN after a week (thru mail)

    Observations in adelaide
    I like it here, we live in a southern suburb around 10 min drive to cbd. Walang traffic and maluwag ang daan. Malapit din sa mga supermarkets and malls tapos nasa tapat ng bahay lang ang bus stop around 20 min lang to adelaide market if commuting. Very convenient. For now yan pa lang ma cocontribute ko. I have submitted a few job applications since 2nd week of jan and received one rejection letter na. Hahaha.. Praying to land a job soon. God bless us all. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    @fufudoods thumbs up for SE suburbs. Hehehe recommended by my colleagues na tanders. Hahah

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • ojdeojde Australia
    Posts: 35Member
    Joined: May 26, 2018
    @chococrinkle about rejection letter. It's better to know outright than to keep you waiting for a response that will never arrive.

    Experienced that myself when I was applying online to Australian and Canadian companies. :)

    ANZSCO 312199 | Architectural, Building and Surveying Technicians nec | Total Points 75 | Visa type 489 (QLD)

    2017-May-24 | IELTS result received
    2018-Aug-07 | VETASSESS outcome received
    2018-Aug-25 | EOI lodged
    2018-Oct-18 | BSMQ invitation received
    2018-Nov-07 | Visa lodged (front loading My Health Declarations and SPF COC)
    2019-Jan-25 | CO (Adelaide) requested for dependent's PCC from country of origin
    2019-Feb-18 | Visa granted. IED 2019-Nov-07

  • SGtoAUSGtoAU hervey Bay
    Posts: 215Member
    Joined: Feb 08, 2015
    @chococrinkle thanks for sharin your experience po and good luck sa job hunting

    I am happy to help If you need a mortgage broker. Email - info@mortgagealley.com.au / www.mortgagealley.com.au

    ****Timeline
    Anszco Code: Construction Project Manager 133111
    28 Oct 17: IELTS test
    15 Apr 18: Skills Assessment Submitted (Vetassess)
    24 May 18: Positive Assessment received from Vetassess
    23 Jul 18: Lodged EOI for Subclass 489 QLD
    28 Aug 18: Received pre-invite from QLD
    04 Sep 18: Submitted all documents to QLD
    12 Sep 18: Received approval from QLD and invitation to apply
    17 Sep 18: Visa lodge
    22 Dec 18: Direct grant 12 Sep 18: Received approval from QLD and invitation to apply
    17 Sep 18: Visa lodge
    22 Dec 18: Direct grant
    01 Aug 2021: Applied for 887 visa
    Currently Waiting for PR grant

  • milktea13milktea13 Philippines
    Posts: 294Member
    Joined: Jun 26, 2018
    Same here! Puro rejection letters pa sa mga inapplyan namin.. nasa pinas pa kami
Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

linhoucailinhoucai123AusJourneymaamafaithauwrkunomigs8Kath06surayyo19921deltaexecutorArvsmauricejanggoIvansnow4004banana24_maishaleonabob34_leepwinkytikatikarikaweesralifeafter23cami0503
Browse Members

Members Online (0) + Guest (153)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌