Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

South Australia State Sponsorship

1707173757697

Comments

  • HendroHendro SG
    Posts: 472Member
    Joined: Mar 31, 2018
    Hello, is there a bearing if in the EOI i select “NO” on the question - would the client be prepared to live outside an australian capital city...

    ANZSCO 311411 | Age :30, Education: 15, Experience: 10, PTE: 10|

    04.04.2018 | Lodged Vetassess Assessment
    05.31.2018 | Vetassess Result : POSITIVE
    06.18.2018 | PTE Mock Test A |LRSW|65/69/79/68|
    06.23.2018 | PTE Mock Test B |LRSW|74/65/84/76|
    06.28.2018 | PTE-A |LRSW|74/73/90/74|
    07.06.2018 | Submitted 190 EOI 65+5=70 pts SA|
    07.08.2018 | Lodged SA State Nomination Application
    10.03.2018 | 190 Invitation Received.
    10.12.2018 | Singapore COC issued
    11.06.2018 | NBI Clearance Issued
    11.17.2018 | Medicals (Point Medical Paragon)
    11.23.2018 | Health Clearance Provided - No Actions Required
    11.23.2018 | Visa Lodgement
    03.04.2019 | Direct Grant! Thank you LORD!
    04.18.2019 | IED | Adelaide
    03.18.2021 | BM | Adelaide

    | Set your goals high, and don't stop till you get there.|

  • supermadisupermadi Singapore
    Posts: 105Member
    Joined: Apr 05, 2018
    Hello po sa aten. Kamusta po ang invitations? Meron po ba nainvite recently? Thank you po.
  • magueromaguero Adelaide
    Posts: 831Member
    Joined: Oct 24, 2016
    @supermadi May nabasa ako sa kabilang forum na naglodge ng application ng July 5 and nacontact today dahil mismatched ang pangalan nya sa documents. Mukhang nagrereview naman sila ng applications, wala nga lang invitations.
  • supermadisupermadi Singapore
    Posts: 105Member
    Joined: Apr 05, 2018
    @maguero Ok po. Thank you sa info. Naku sana nga talaga mainvite na tayo lahat.
  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @kimpoy They dont usually ask for proof of financial capacity. They will just ask you to sign a declaration of the total assets you have which will show that you can support yourself on your first months in au.

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • kimpoykimpoy South Australia
    Posts: 203Member
    Joined: Oct 27, 2016
    @chococrinkle salamat po sa reply :)

    ANZSCO 312311 | Electrical Engineering Draftsperson |

    29.04.2017 |IELTS GT |LRSWO|6.0/7.0/6.5/6.0|6.5
    05.04.2018 | PTE-A |LRSWO|62/75/64/68|68
    21.05.2018 | PTE-A |LRSWO|57/56/24/67|51 (microphone malfunction at the start)
    15.04.2018 | Lodged Engineers Australia Assessment
    31.05.2018 | Engineers Australia: POSITIVE Assessment result
    06.07.2018 | Submitted EOI (Visa 489) with 55+10 = 65 pts (for South Australia)
    30.07.2018 | Lodged South Australia State Nomination Application
    26.10.2018 | ITA Received: 489 (South Australia)
    06.12.2018 | Submitted Application for Visa 489
    04.06.2019 | Visa 489 Granted [Direct Grant]
    16.08.2019 | 1st Entry in Adelaide, SA from Singapore (4 days then returned to work in Singapore)

    2020-2021 | Australia border closure/travel restrictions

    04.07.2021 | Arrived in USA from Singapore
    30.12.2021 | Arrived in Sydney from the USA
    31.12.2021 | Domestic air transfer to Melbourne from Sydney
    09.01.2022 | Moved to Adelaide from Melbourne
    18.02.2022 | Visa 489 validity extended (7 years in total) by the Australian Gov't (due to border closure)
    16.03.2022 | Started work as a hotel housekeeping cleaner
    03.05.2022 | Started work in my nominated occupation
    07.02.2024 | Submitted Application for Visa 887
    20.12.2024 | s56 received for Health Examinations (both applicants)
    31.12.2024 | Health Examinations cleared
    12.02.2025 | Uploaded New Australia Federal Police Clearance (AFP)
    08.07.2025 | Visa 887 Granted

  • beetle00beetle00 Posts: 101Member
    Joined: Jan 08, 2018
    edited August 2018
    @kimpoy parehas tayo ng nangyari, what I did was gumawa ako ng bagong application so meaning 2 ang application ko. Isa yung nagkaerror which is stuck at "Payment in Progress" at yung isa ay bayad na kaya "Lodged" na ang nakalagay. Nag e-mail nalang ako sa kanila sa nangyari sakin at sinabi ko iproproceed ko yung "Lodged" application ko. Mahirap na kasi baka maubusan pa ako ng slots kakaintay sa reply nila. :)

    Just an update, nagreply na sa e-mail and they have said na tama nga yung ginawa ko. Just ignore the initial application as long as lodged na yung bago mo :)
  • kimpoykimpoy South Australia
    Posts: 203Member
    Joined: Oct 27, 2016
    @beetle00 Ganun na din yung ginawa ko. Gumawa ako ng new application then binayaran ko. Then after ilang oras nakareceived ako ng email regarding my 1st application tapos may option na pwede ng bayaran to push thru with the lodging. Ignore ko na lang yung 1st application kasi indicated that it will be deleted after 7 days without receiving any payment. Baka madami lang mga nagsasubmit ng application kaya may lag yung system nila.

    ANZSCO 312311 | Electrical Engineering Draftsperson |

    29.04.2017 |IELTS GT |LRSWO|6.0/7.0/6.5/6.0|6.5
    05.04.2018 | PTE-A |LRSWO|62/75/64/68|68
    21.05.2018 | PTE-A |LRSWO|57/56/24/67|51 (microphone malfunction at the start)
    15.04.2018 | Lodged Engineers Australia Assessment
    31.05.2018 | Engineers Australia: POSITIVE Assessment result
    06.07.2018 | Submitted EOI (Visa 489) with 55+10 = 65 pts (for South Australia)
    30.07.2018 | Lodged South Australia State Nomination Application
    26.10.2018 | ITA Received: 489 (South Australia)
    06.12.2018 | Submitted Application for Visa 489
    04.06.2019 | Visa 489 Granted [Direct Grant]
    16.08.2019 | 1st Entry in Adelaide, SA from Singapore (4 days then returned to work in Singapore)

    2020-2021 | Australia border closure/travel restrictions

    04.07.2021 | Arrived in USA from Singapore
    30.12.2021 | Arrived in Sydney from the USA
    31.12.2021 | Domestic air transfer to Melbourne from Sydney
    09.01.2022 | Moved to Adelaide from Melbourne
    18.02.2022 | Visa 489 validity extended (7 years in total) by the Australian Gov't (due to border closure)
    16.03.2022 | Started work as a hotel housekeeping cleaner
    03.05.2022 | Started work in my nominated occupation
    07.02.2024 | Submitted Application for Visa 887
    20.12.2024 | s56 received for Health Examinations (both applicants)
    31.12.2024 | Health Examinations cleared
    12.02.2025 | Uploaded New Australia Federal Police Clearance (AFP)
    08.07.2025 | Visa 887 Granted

  • kimpoykimpoy South Australia
    Posts: 203Member
    Joined: Oct 27, 2016
    @beetle00 pero wala akong nareceive na email sa SA regarding sa query ko. Nareceive ko lang yung auto generated email msg nila to pay my 1st application.

    ANZSCO 312311 | Electrical Engineering Draftsperson |

    29.04.2017 |IELTS GT |LRSWO|6.0/7.0/6.5/6.0|6.5
    05.04.2018 | PTE-A |LRSWO|62/75/64/68|68
    21.05.2018 | PTE-A |LRSWO|57/56/24/67|51 (microphone malfunction at the start)
    15.04.2018 | Lodged Engineers Australia Assessment
    31.05.2018 | Engineers Australia: POSITIVE Assessment result
    06.07.2018 | Submitted EOI (Visa 489) with 55+10 = 65 pts (for South Australia)
    30.07.2018 | Lodged South Australia State Nomination Application
    26.10.2018 | ITA Received: 489 (South Australia)
    06.12.2018 | Submitted Application for Visa 489
    04.06.2019 | Visa 489 Granted [Direct Grant]
    16.08.2019 | 1st Entry in Adelaide, SA from Singapore (4 days then returned to work in Singapore)

    2020-2021 | Australia border closure/travel restrictions

    04.07.2021 | Arrived in USA from Singapore
    30.12.2021 | Arrived in Sydney from the USA
    31.12.2021 | Domestic air transfer to Melbourne from Sydney
    09.01.2022 | Moved to Adelaide from Melbourne
    18.02.2022 | Visa 489 validity extended (7 years in total) by the Australian Gov't (due to border closure)
    16.03.2022 | Started work as a hotel housekeeping cleaner
    03.05.2022 | Started work in my nominated occupation
    07.02.2024 | Submitted Application for Visa 887
    20.12.2024 | s56 received for Health Examinations (both applicants)
    31.12.2024 | Health Examinations cleared
    12.02.2025 | Uploaded New Australia Federal Police Clearance (AFP)
    08.07.2025 | Visa 887 Granted

  • ray1188ray1188 Manila
    Posts: 163Member
    Joined: Sep 13, 2016
    @chococrinkle pwede po bang magtanong? usually nung nag file ng 489 for SA inalis mo ba yung 190 applicaiton nyo sa ibang states? Kasi sa part ko 489 ang pwede i apply pero may mga EOI ako for 190 visa to NSW and Victoria. Any inputs po? Iniisip ko mag withdraw ng other EOI pag naka tanggap na ng pre invite.What do yout think po? Salamat din po sa inputs ng iba :)

    261312 Developer Programmer (Age:30 | English: 20 | Education: 10 | Experience: 10 = Total: 70 (189)|75 (190)

    July 04, 2016 - Started researching about AU migration
    September 13, 2016 - joined pinoyau forum
    December 02, 2016 - started collating documents for ACS
    February 2017 - started reviewing for PTE-A
    May 31, 2017 - CTC'd documents
    June 01, 2017 - Submitted ACS
    June 2017 - Reviewing for PTE Academic
    July 13, 2017 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted)

    -----TIME FOR PTE, ROAD TO SUPERIOR-----------

    March 12, 2018 - PTE Academic L/R/S/W - 73/84/90/71
    March 20,2018 - PTE Academic L/R/S/W - 74/82/90/71
    July 05, 2018 - PTE Academic L/R/S/W - 82/71/90/76
    July 19, 2018 - PTE Academic L/R/S/W - 77/84/90/82

    July 26, 2018 - PTE Academic L/R/S/W - 90/84/90/90 - All Glory Belongs to our God!!! Thank you Jesus!

    July 27, 2018 - Lodge EOI for 65 points for 189 and 70 points for 190 for any states
    Nov 15, 2018 - Re Assessment result received + 5 points

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @ray1188 Hi! Yung occupation ko is available lang sa SA and 489 visa lang ang pwede kong applyan kaya yun lang talaga naging application namin.

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • magueromaguero Adelaide
    Posts: 831Member
    Joined: Oct 24, 2016
    @ray1188 AFAIK walang pre-invite sa SA. Derechong ITA sila kung successful ang application mo.
  • supermadisupermadi Singapore
    Posts: 105Member
    Joined: Apr 05, 2018
    Hello po sa aten lahat. Update lang po, nareceive na po namen ITA namen today lang. Salamat kay Lord. Sana sunod sunod na tayo lahat. :)
  • magueromaguero Adelaide
    Posts: 831Member
    Joined: Oct 24, 2016
    @supermadi That's good news. Gaano katagal bago kayo nainvite?
  • supermadisupermadi Singapore
    Posts: 105Member
    Joined: Apr 05, 2018
    @maguero Yes sir, good news po talaga. Awa naman naibigay din po. 7 weeks po bale sir yung samen. Ngayon naman ang kinakabahan kame yung sa visa grant. May nadedecline pa po kaya sa stage na to?
  • HendroHendro SG
    Posts: 472Member
    Joined: Mar 31, 2018
    edited August 2018
    @supermadi Congrats po! All the best! :) Ilan po ang points nyo when you submitted without SA nomination?

    ANZSCO 311411 | Age :30, Education: 15, Experience: 10, PTE: 10|

    04.04.2018 | Lodged Vetassess Assessment
    05.31.2018 | Vetassess Result : POSITIVE
    06.18.2018 | PTE Mock Test A |LRSW|65/69/79/68|
    06.23.2018 | PTE Mock Test B |LRSW|74/65/84/76|
    06.28.2018 | PTE-A |LRSW|74/73/90/74|
    07.06.2018 | Submitted 190 EOI 65+5=70 pts SA|
    07.08.2018 | Lodged SA State Nomination Application
    10.03.2018 | 190 Invitation Received.
    10.12.2018 | Singapore COC issued
    11.06.2018 | NBI Clearance Issued
    11.17.2018 | Medicals (Point Medical Paragon)
    11.23.2018 | Health Clearance Provided - No Actions Required
    11.23.2018 | Visa Lodgement
    03.04.2019 | Direct Grant! Thank you LORD!
    04.18.2019 | IED | Adelaide
    03.18.2021 | BM | Adelaide

    | Set your goals high, and don't stop till you get there.|

  • MiaMia NZ
    Posts: 324Member
    Joined: Oct 27, 2011
    @supermadi siguro po kung di magsubmit ng ITA documents made-decline :) Na i lodge niyo na po ba?
  • supermadisupermadi Singapore
    Posts: 105Member
    Joined: Apr 05, 2018
    @Hendro Thank you po, sir. Sana tuloy tuloy na. :) Bale 60 points po without SA nomination.
  • supermadisupermadi Singapore
    Posts: 105Member
    Joined: Apr 05, 2018
    @Mia Ok po. Sana talaga tuloy tuloy na. Hindi pa po. Siguro po by end of this week. Dito rin po sa stage na to yung medical tama po ba? Or sa huli na po yun hingin?
  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @supermadi For state sponsored visa medyo mataas na chance of approval kasi it was already pre checked by the state. SA is asking for documents already when applying for State nomination so they have already assessed your docs, and based on experience with SA they advise when they see something wrong sa EOI. As long as you did not overclaim points and you submit all documents pertaining to the occupation, most likely you’ll get your visa grant. God bless you.

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • supermadisupermadi Singapore
    Posts: 105Member
    Joined: Apr 05, 2018
    @chococrinkle Thank you po sa clarification. Lahat naman po ng hiningi samen napasa na namen. Sana nga po tuloy tuloy na. Based on experience po, how long does it usually take po for the grant? Nabasa ko po sa website kasi for 489 parang 7-10 months.
  • RheaMARN1171933RheaMARN1171933 Posts: 2,822Member, Administrator, Moderator
    Joined: Mar 10, 2016
    @supermadi @chococrinkle state sponsorship doesn’t really give one an indication na mataas chance of approval. 189, 190 and 489, or any skilled visa have the same chances of approval/refusal when it comes to visa application stage. The usual cause of unsuccessful application at the latter part is either health or character issues which would not have been identified in the prior stages. Good luck!
  • supermadisupermadi Singapore
    Posts: 105Member
    Joined: Apr 05, 2018
    @RheaMARN1171933 Got it po. So unti then na ma-visa grant talaga kailangan parin prayers. Di parin masyado talaga kampante. Salamat po sa insight. Thank you.
  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @RheaMARN1171933 Noted po. Thank you for clarifying. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @supermadi Yes pray hard for it, if its God’s will it will be given to you. Processing times vary depending sa published ng DHA, during our time around 5 to 8 months yata ang nkapublish na processing times but we got our DG in 3 months. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • Pandabelle0405Pandabelle0405 Singapore
    Posts: 691Member
    Joined: Aug 16, 2017
    @maguero hello sir ask ko lng po totoo po ba wala pre invite sa SA pag ganun mas ok pala how about sa victoria my idea po ba kau kc samin nag lodge kami eoi Aug 1 then nkareceive ng acknowledge Aug 3 na po sabi sa email wait lng daw 12 weeks may result na if reject or approved. Mukha bago n ata rules ngaun ng mga state except nsw may pre invite cla.
  • supermadisupermadi Singapore
    Posts: 105Member
    Joined: Apr 05, 2018
    @chococrinkle More prayers pa po. Thank you po sa positive support. Sana kame rin po mabilis lang namen makuha ang visa. At sana sunod sunod na ang ITA sa lahat saten dito na naghihintay. Marami po salamat ulit. :)
  • magueromaguero Adelaide
    Posts: 831Member
    Joined: Oct 24, 2016
    @Pandabelle0405 Walang pre-invite sa SA kasi ang process dun is kailangan talaga magsubmit ng separate application directly sa SA pagkatapos magsubmit ng EOI. Tapos SA will make a decision based on the application na sinubmit sa kanila. Hindi ako familiar sa Victoria pero sa SA ang processing time is 15-20 weeks.
  • DricksterDrickster Adelaide, SA
    Posts: 131Member
    Joined: Jul 10, 2018
    Someone from India got an invite from SA.
    Here is his timeline:

    ICT Business Analyst: 261111

    Points - Age:25,Edu:15,Exp:10,PTE:10 = 60

    10-Oct-2016: ACS completed
    21-Dec-2016: PTE cleared
    30-June-2017: EOI submitted for Vic 190
    5-July-2018: EOI submitted for SA: 489
    31-July-2018: Assessment office contact on the name mismatch b/w passport and application
    13-Aug-2018: Approval received from SA


    Malapit na rin kaya tayo?
  • supermadisupermadi Singapore
    Posts: 105Member
    Joined: Apr 05, 2018
    Good morning po. Sa mga nakapag lodge na po ng visa or kung sino po may idea, pano po kaya ang medical? I mean simple phyaical lang po ba, blood test etc? And paano pa kaya pag sa bata? Salamat po sa sasagot.
Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

Kath06surayyo19921deltaexecutorArvsmauricejanggoIvansnow4004banana24_maishaleonabob34_leepwinkytikatikarikaweesralifeafter23cami0503brendamiijamesedwardjabbabsEAVjennifer_hope_ngoAljean
Browse Members

Members Online (0) + Guest (173)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌