Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

Migrating to Australia with high hopes

11012141516

Comments

  • mdnellemdnelle Manila
    Posts: 30Member
    Joined: May 29, 2017
    @chococrinkle following your query and interested sa response.

    Sa Philippines/outside AU po ba kayo magopen bank account? :)

    External Auditor (221213) | Age = 30 | Education = 15 | Experience = 10 | English = 20 | TOTAL = 75 pts

    2017.05.13 - Took GT IELTS
    2017.05.25 - GT IELTS result (L= 8.5, R=9, W=7, S=7)
    2017.05.29 - Consulted Migration Agent
    2017.06.13 - PTE Academic (scheduled)
    2017.06.15 - PTE Academic result (L= 9, R=9, W=9, S=9)
    2017.08.28 - CAANZ favorable skills assessment
    2017.08.30 - EOI lodgement

    -----------ITA received 2018.01.03--------------

    2018.02.15 - Visa lodgement
    2018.03.05 - Health clearance

    -----------DG 2018.07.11--------------

    .... planning for IED & BM

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @mdnelle Yup dito kami pinas mag open. For BM kasi daan muna sydney ng 1 week before pumunta ng SA so if pwede naman makuha agad sa sydney yung debit card after verification, then dun nalang namin kunin. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • agentKamsagentKams Toowoomba
    Posts: 861Member
    Joined: Apr 25, 2014
    @chococrinkle iyong debit card isesend po sa address niyo sa AU.

    Timeline: Student Visa Subclass 573 (Masters)
    06 July 2015: Visa Grant
    April 2018: Uni Graduation

    Timeline: Permanent Visa (189) Accountant 221111
    18 April 2018: ITA received - Visa 189
    04 May 2018 : Lodged Visa Application - Visa 189
    29 Aug 2018 - First CO Contact - PCC Qatar (partner)
    9 Jan 2019 - 2nd CO Contact - penal waiver
    18 Jan 2019 - Updated immiaccount with penal waiver
    29 Jan 2019 - Forwarded PCC to gsm.allocated email
    8 Feb 2019 - Visa Grant - Finally!!

    Timeline: Citizenship
    July 2020: Application lodgment
    May 2021: Citizenship Exam
    Feb 2022: Oi! Oi! Oi! Aussie na din sa wakas!

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @agentKams Thanks for your reply. So possible ba that we indicate Adelaide address on the account application but we do the 100 pts verification in Sydney?

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • agentKamsagentKams Toowoomba
    Posts: 861Member
    Joined: Apr 25, 2014
    @chococrinkle that I am not sure. you can email the bank officer assigned to you once they have opened your account. goodluck sa BM!

    Timeline: Student Visa Subclass 573 (Masters)
    06 July 2015: Visa Grant
    April 2018: Uni Graduation

    Timeline: Permanent Visa (189) Accountant 221111
    18 April 2018: ITA received - Visa 189
    04 May 2018 : Lodged Visa Application - Visa 189
    29 Aug 2018 - First CO Contact - PCC Qatar (partner)
    9 Jan 2019 - 2nd CO Contact - penal waiver
    18 Jan 2019 - Updated immiaccount with penal waiver
    29 Jan 2019 - Forwarded PCC to gsm.allocated email
    8 Feb 2019 - Visa Grant - Finally!!

    Timeline: Citizenship
    July 2020: Application lodgment
    May 2021: Citizenship Exam
    Feb 2022: Oi! Oi! Oi! Aussie na din sa wakas!

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @agentKams Noted on that. Thank you. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • LracLrac Singapore
    Posts: 56Member
    Joined: May 23, 2017
    @chococrinkle sa mga nabasa namin dito sa forum, some said you can verify it sa ibang branch pero based on observation, kaya nilalagay mo yung preferred branch because the bank's main office will send your ATM dun. Once andun ka na, the officer will just check your 100 points of identification and give you your ATM on that day. If you will activate it in other branches, I think there will be a waiting period like 3-5 days.
  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @Lrac Thanks for your feedback. Hmm.. maybe its best to ask nalang the bank officer on our best option. Thanks a lot. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • dyanisabelledyanisabelle Sydney
    Posts: 210Member
    Joined: Sep 22, 2016
    @Lrac @chococrinkle this is true. Yung branch na inindicate ko nung nag apply ako offshore, hindi ko pinuntahan nung nag activate ako haha. Sinubukan lang kasi namin sa random NAB branch sa mall. Pwede naman, naactivate naman pero yung cards daw namin nandun sa inindicate kong branch. So inorderan nalang kami nung officer ng bagong cards tapos pinadala thru mail sa address namin.

    221214 Internal Auditor : 189 - 75pts / 190 - 80pts (Age:30/Educ:15/Exp:10/English:20/SS:5)

    20/12/2016 - Submitted docs to Vetassess
    16/02/2017 - Positive assessment (4.1 yrs) - 5pts
    08/08/2017 - Live in anniversary
    04/09/2017 - PTE Take 1 : L81/R75/S45/W89
    25/09/2017 - PTE Take 2 : L83/R89/S58/W90
    04/10/2017 - PTE Take 3 : L90/R90/S90/W90 - 20pts Yay! ^_^
    06/10/2017 - Lodged EOI for 189 and 190 NSW
    20/10/2017 - ITA from NSW received (75 pts)
    21/10/2017 - Submitted application to NSW
    08/11/2017 - Updated skilled work experience - 10pts
    21/11/2017 - ITA from DIBP received 190 NSW
    07/12/2017 - Visa Lodged
    09/12/2017 - Medicals at Nationwide Manila
    14/12/2017 - Cleared medicals - de facto partner
    21/12/2017 - Cleared medicals - mine
    16/02/2018 - VISA GRANT :)

  • dyanisabelledyanisabelle Sydney
    Posts: 210Member
    Joined: Sep 22, 2016
    @mdnelle we applied for medicare the day after our arrival, oks naman. Hehe

    221214 Internal Auditor : 189 - 75pts / 190 - 80pts (Age:30/Educ:15/Exp:10/English:20/SS:5)

    20/12/2016 - Submitted docs to Vetassess
    16/02/2017 - Positive assessment (4.1 yrs) - 5pts
    08/08/2017 - Live in anniversary
    04/09/2017 - PTE Take 1 : L81/R75/S45/W89
    25/09/2017 - PTE Take 2 : L83/R89/S58/W90
    04/10/2017 - PTE Take 3 : L90/R90/S90/W90 - 20pts Yay! ^_^
    06/10/2017 - Lodged EOI for 189 and 190 NSW
    20/10/2017 - ITA from NSW received (75 pts)
    21/10/2017 - Submitted application to NSW
    08/11/2017 - Updated skilled work experience - 10pts
    21/11/2017 - ITA from DIBP received 190 NSW
    07/12/2017 - Visa Lodged
    09/12/2017 - Medicals at Nationwide Manila
    14/12/2017 - Cleared medicals - de facto partner
    21/12/2017 - Cleared medicals - mine
    16/02/2018 - VISA GRANT :)

  • gracee04gracee04 Singapore
    Posts: 57Member
    Joined: Sep 29, 2017
    Just following this thread ksi for BM na din kame ni hubby this October. Napakalaking tulong talaga ng forum na ito

    312111 Architectural Draftsperson 70pts 190 NSW

    21/Aug/2017 PTE exam
    28/Aug/2017 PTE Result L76, R80, S79, W80
    12/Oct/2017 EOI 190 NSW
    17/Nov/2017 Pre Invite 190 NSW
    20/Nov/2017 SS Application 190 NSW
    22/Jan/2018 SS Approved/ITA 190 NSW
    27/Feb/2018 Visa Lodge/Uploaded all documents

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @dyanisabelle Thanks for the feedback.

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • LexiLexi Mandaluyong
    Posts: 208Member
    Joined: Sep 10, 2016
    Guys, NSW visa 190 ako. Pwede ba ko mag-initial entry sa ibang states, like Melbourne? Ma-question kaya ako ng immigration officer?
    Thanks! :)

    221111 Gen. Accountant
    04/13/17 - CPAA Positive Assessment
    08/2016 - 11/2017 - PTE Journey
    11/29/17 - EOI 189 - 75 pts.
    01/09/18 - EOI 190 NSW
    02/02/18 - NSW Pre-invite
    02/09/18 - Submitted NSW application
    03/22/18 - ITA/NSW Approval
    04/06/18 - Lodge Visa 190
    07/11/18 - Direct Grant (worth the wait!)

  • EGMS_AU2017EGMS_AU2017 Singapore
    Posts: 439Member
    Joined: Sep 19, 2017
    @dyanisabelle hi mam ask ko lang po kht sa ibang state ka titira pede ba apply ng medicare? Plan kc nmin mag sydney muna then melbourne po magsettle. Can we activate it sa sydney kht few days lang kami dun? Thank u po
  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    @Lexi yep, tingin ko pede.

    @EGMS_AU2017 yes, pede. Although you need a permanent residential address dito sa AU, kase dun nila ipapadala yung card. Kung lumipat ka man ng ibang states, pede mag update ng address.

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • LexiLexi Mandaluyong
    Posts: 208Member
    Joined: Sep 10, 2016
    @Heprex Thanks bro. I plan to do my initial entry in Melbourne by October before moving to Sydney after a few weeks. Hirap ng walang kakilala sa Sydney eh :D

    221111 Gen. Accountant
    04/13/17 - CPAA Positive Assessment
    08/2016 - 11/2017 - PTE Journey
    11/29/17 - EOI 189 - 75 pts.
    01/09/18 - EOI 190 NSW
    02/02/18 - NSW Pre-invite
    02/09/18 - Submitted NSW application
    03/22/18 - ITA/NSW Approval
    04/06/18 - Lodge Visa 190
    07/11/18 - Direct Grant (worth the wait!)

  • MeggerMegger Sydney
    Posts: 913Member
    Joined: Nov 15, 2014
    sa mga nakapag big move na. I understand mahirap makakuha ng bahay sa Sydney, ano ba mga docs na hinahanap ng mga agents, at ano pwed mo gamiting leverage para ma secure yong bahay specially kung job hunting stage ka pa. Salamat sa mga sasagot.

    312312 - (Electrical Engineering Technician) Primary

    11/27/2015 - Lodge TRA assessment application
    02/26/2016 - Received TRA outcome letter
    04/19/2016 - lodge vetasses qualification assessment.
    05/20/2016- Received Vetassess PTA, AQF Bachelors Degree
    05/21/2016- Lodge SS for SA
    06/06/2016- Received ITA SS SA
    06/11/2016- Lodge SS for NSW
    06/27/2016- Received ITA SS NSW ( God is great! thank you Lord)
    07/14/2016- Medical Cleared
    07/31/2016- lodge ITA NSW
    08/05/2016- Uploaded NBI. Waiting.. In His time everything is right..,
    23/11/2016- Grant ( Thanks Lord God )

  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011
    @Lexi congrats! granted ka na pala. :)

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • LexiLexi Mandaluyong
    Posts: 208Member
    Joined: Sep 10, 2016
    @batman Thanks bro! Nung last month ko nakuha. Eto excited na maghanap ng work at sa big move. Plan ko sa October na agad haha. Pero di ko na ko naka-exam ng Ethics, naging busy kaya na-defer ko.

    Sana may grant ka na din soon :)

    221111 Gen. Accountant
    04/13/17 - CPAA Positive Assessment
    08/2016 - 11/2017 - PTE Journey
    11/29/17 - EOI 189 - 75 pts.
    01/09/18 - EOI 190 NSW
    02/02/18 - NSW Pre-invite
    02/09/18 - Submitted NSW application
    03/22/18 - ITA/NSW Approval
    04/06/18 - Lodge Visa 190
    07/11/18 - Direct Grant (worth the wait!)

  • kuberakubera ph
    Posts: 44Member
    Joined: May 14, 2017
    @Megger

    Bank statment, medicare, photo card or drivers license, passport
  • kuberakubera ph
    Posts: 44Member
    Joined: May 14, 2017
    @Heprex

    Nakapag BM ka na? Diba IT ang field mo? Kamusta job hunting?
  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    @kubera yep, nakapag BM na. Hehee di pa ako nag jjob hunting. Nag aantay na lang ako maaprove relocation ko dito para di ko na need mag resign, although nag wowork na ako dito sa melb opis namin, pero pinas pa din sweldo until ma finalise.

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • anamarieanamarie Sydney
    Posts: 59Member
    Joined: Jan 11, 2018
    @Heprex congrats sir, dirediretso na ang aussie life, npkaganda pa ng transition ng work!
  • mdnellemdnelle Manila
    Posts: 30Member
    Joined: May 29, 2017
    @Heprex ang galing naman po na me affiliate un Company nyo sa Melbourne!

    External Auditor (221213) | Age = 30 | Education = 15 | Experience = 10 | English = 20 | TOTAL = 75 pts

    2017.05.13 - Took GT IELTS
    2017.05.25 - GT IELTS result (L= 8.5, R=9, W=7, S=7)
    2017.05.29 - Consulted Migration Agent
    2017.06.13 - PTE Academic (scheduled)
    2017.06.15 - PTE Academic result (L= 9, R=9, W=9, S=9)
    2017.08.28 - CAANZ favorable skills assessment
    2017.08.30 - EOI lodgement

    -----------ITA received 2018.01.03--------------

    2018.02.15 - Visa lodgement
    2018.03.05 - Health clearance

    -----------DG 2018.07.11--------------

    .... planning for IED & BM

  • MeggerMegger Sydney
    Posts: 913Member
    Joined: Nov 15, 2014
    edited August 2018
    kubera said:

    @Megger



    Bank statment, medicare, photo card or drivers license, passport

    thanks.. @kubera , gaano ka katagal nakakuha ng house?

    312312 - (Electrical Engineering Technician) Primary

    11/27/2015 - Lodge TRA assessment application
    02/26/2016 - Received TRA outcome letter
    04/19/2016 - lodge vetasses qualification assessment.
    05/20/2016- Received Vetassess PTA, AQF Bachelors Degree
    05/21/2016- Lodge SS for SA
    06/06/2016- Received ITA SS SA
    06/11/2016- Lodge SS for NSW
    06/27/2016- Received ITA SS NSW ( God is great! thank you Lord)
    07/14/2016- Medical Cleared
    07/31/2016- lodge ITA NSW
    08/05/2016- Uploaded NBI. Waiting.. In His time everything is right..,
    23/11/2016- Grant ( Thanks Lord God )

  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    @mdnelle @anamarie thank youu!!

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • atheleneathelene Brisbane
    Posts: 766Member
    Joined: Mar 13, 2018
    edited August 2018
    Hello hello~

    Medyo nakapagsettle na ako kahit papaano sa Sydney (as student, not PR po). The first things I did were to apply for the NSW Photo Card, tax file number (even though wala pa rin akong work till now haha), open bank accounts, and activate OSHC (Medibank). I'd like to share my personal experiences and thoughts about them.

    Everything was a painless process, at least to me. For all of these, ang usually hinahanap ay Australian address; some may take up to 2 weeks (10 business days) to receive in the mail, so it's ideal that you have a place to "crash" if you haven't found a place to stay permanently, maybe for at least 3 weeks.

    Banking

    I applied for Commbank and Westpac accounts while overseas, and apparently those were the transaction accounts. Sa Westpac I think I nominated the one in Sydney CBD (Martin Place), so I went there, bringing only my passport, visa, eCoE. They were able to verify my identity using my passport and eCoE (wala na silang hiningi na iba).

    The bank officer will usually offer to open a savings account for you (no minimum deposit required, unlike sa Pinas), and they'll print out like a bank letter indicating your bank account number/details. They'll ask for your address, since they'll send your ATM card to that address (I received Westpac card 4 business days after activating my account).

    For Commbank, I just went to the one on uni campus and just showed passport and eCoE din. Commbank card took longer, I believe (not sure which day it arrived, but definitely within 10 business days).

    The banks would also ask for your Australian mobile number, but since I told them I didn't have one yet, they said I can just update my contact details later.

    NSW Photo Card

    The NSW Photo Card is pretty handy for international students, so apply for one as soon as you arrive (if you're not applying for a driver's license). If PR, I'm not sure if you have a different kind of identity card or ito rin yung kailangan niyo hehe. You can simply go to any Services NSW centre; bring along your passport and bank statement showing your Australian address. I asked if the welcome letter from the bank was permissible, despite it showing my PH address, but surprisingly they said it was fine.

    One of the staff gave me an application form and helped me photocopy my documents, and then they gave me a ticket for the queue. At the counter, you just need to submit your application form, photocopy and original passport and bank statement/letter. Then they'll take a photo of you on the spot (my pic turned out ok despite feeling so haggard that time hahaha), and then you'll have to pay the processing fee (I paid AUD 54, for a 3-year validity).

    My NSW Photo Card arrived 3 business days after application. Since they're pretty strict here in Australia about drinking alcohol when underage, you can simply show your Photo Card when entering bars (Asians like us look very young on this side of the world).

    Tax File Number (TFN)

    I applied for this the same day I arrived in Sydney. You can just apply online at ATO website. They will ask you for Australian address, because they will send a letter with your TFN details (they won't issue this TFN over the web, like the TIN in Pinas). The letter from ATO with my TFN details arrived 5 working days after application.

    OSHC (Medibank)

    This may not be relevant for PRs reading this, but I figured I might as well share this in case may mga fellow students na napadpad dito hehe.

    I received an email from Medibank reminding me to activate my OSHC upon arrival in Australia, and I did it online on Medibank's website. If your OSHC provider is not Medibank, check your provider's website if they have a menu or page that allows you to activate it (if necessary to activate lang ha, sa Medibank kasi kailangan). Once I activated my OSHC, I applied for a physical card, since I preferred that to a (downloadable) "digital card." Please note that it is NOT necessary to apply for a physical card, but I thought it might be handier than having to rummage through my phone for that "digital card."

    The physical card arrived in the mail about 5 business days after online application.

    Australian Mobile Number

    I only picked up a prepaid sim card maybe 4-5 days after I arrived; I just got the cheap Amaysim AUD 10 sim card from Coles. You'll find these sim cards near the cashier/counter, usually outside the store pa. You can grab which one you want and pay for it sa counter. The Amaysim sim card pack did not have that small pin to release the sim tray (and I assume ganun din sa iba).

    SUPER TIP: I discovered later on that at Central Station, the tourism/visitor centre there has tons of free brochures. And they have free Vodaphone sim pack (AUD 2 worth daw, but you have to recharge/load it up to be able to use it), that includes the small pin for the sim tray! May free sim card ka na, may pin pa hehehe!

    Anyway, for the prepaid sim card, you have to activate it online and to be able to select your mobile plan and number (I just chose a memorable one from the offered options). If you don't like your current mobile provider, you can change to a new one (if you're not on a contract) and transfer your existing number (they call it porting).

    Since I wanted a cheap prepaid plan, I transferred to Jeenee Mobile. I had to wait several days to receive the new sim card from Jeenee; again, you have to activate the new sim and apply for porting. Porting took maybe 3 normal days before the sim was fully functional (I applied for porting on Friday night, and the sim was usable around Monday afternoon).



    So there~ I hope my tips would help you figure out how to get started in settling in Australia~ :)

    232111 (Architect) | Current points: 65

    30-01-2018 Applied for student visa (MArchSci), offshore application.
    11-08-2020 Applied for student visa (PhD), onshore application.
    28-02-2022 Submitted application to AACA for skills assessment (OQA Stage 1)
    27-05-2022 Received skills assessment outcome (Suitable/Positive)
    Next steps: PTE exam

  • dyanisabelledyanisabelle Sydney
    Posts: 210Member
    Joined: Sep 22, 2016
    @athelene binibigay pala nilang free yang 2aud na vodafone sim. Binili pa namin yan, sayang ang 2. Hahaha! Nahassle pa kami nyan kasi di namin maactivate nung una. Magkano gastos mo for mobile?

    221214 Internal Auditor : 189 - 75pts / 190 - 80pts (Age:30/Educ:15/Exp:10/English:20/SS:5)

    20/12/2016 - Submitted docs to Vetassess
    16/02/2017 - Positive assessment (4.1 yrs) - 5pts
    08/08/2017 - Live in anniversary
    04/09/2017 - PTE Take 1 : L81/R75/S45/W89
    25/09/2017 - PTE Take 2 : L83/R89/S58/W90
    04/10/2017 - PTE Take 3 : L90/R90/S90/W90 - 20pts Yay! ^_^
    06/10/2017 - Lodged EOI for 189 and 190 NSW
    20/10/2017 - ITA from NSW received (75 pts)
    21/10/2017 - Submitted application to NSW
    08/11/2017 - Updated skilled work experience - 10pts
    21/11/2017 - ITA from DIBP received 190 NSW
    07/12/2017 - Visa Lodged
    09/12/2017 - Medicals at Nationwide Manila
    14/12/2017 - Cleared medicals - de facto partner
    21/12/2017 - Cleared medicals - mine
    16/02/2018 - VISA GRANT :)

  • atheleneathelene Brisbane
    Posts: 766Member
    Joined: Mar 13, 2018
    @dyanisabelle At first i kinda regretted buying the amaysim sim card, but when i realized how that free vodafone sim worked, parang mas tipid ung amaysim hahaha. Poor student lang ako kaya low-cost plan lang ang kinuha ko sa Jeenee, AUD 24/month on a 12-month contract; unli calls+text, plus 10Gb data. Since bahay-uni lang ako, nagagamit lang yung data habang nagccommute or when I'm outside uni buildings. My typical monthly data consumption is around 6-8Gb, so 10Gb is more than enough.

    232111 (Architect) | Current points: 65

    30-01-2018 Applied for student visa (MArchSci), offshore application.
    11-08-2020 Applied for student visa (PhD), onshore application.
    28-02-2022 Submitted application to AACA for skills assessment (OQA Stage 1)
    27-05-2022 Received skills assessment outcome (Suitable/Positive)
    Next steps: PTE exam

  • kittykitkat18kittykitkat18 Sydney
    Posts: 908Member
    Joined: May 13, 2015
    @Megger single or married? Based on our experience, we submitted the following - bank statements, certificate of employment, id’s, credit card statement, reference letter from previous landlord (shared house and we just requested a letter from the owner of the house) Approved in one day. Maybe both of us are working. Another unit we inspected responded after a month saying we have a strong application and if we are still interested to secure the unit. Before submitting the documents we wrote the agent a letter stating our interest in the unit (eg. near our workplace, safe environment, family friendly suburb, peaceful area, near train and schools)

    Computer network and systems engineer (263111) - Hubby is main applicant - Mapua (BS-ECE)
    07.23.15 - submitted ACS
    07.27.15 - ACS result - suitable..AQF Bachelor. 2 yrs deduction. 5yrs and 10 mos credited
    09.28.15 - PTE scheduled exam (Sg)
    09.29.15 - PTE Results. L - 90, R - 86, S - 90, W - 86. Overall = 90
    09.30.15 - Submitted EOI Visa 189 - 70 pts
    10.09.15 - Invitation received
    10.28.15 - medicals (me & hubby) @ Point Medical Sg
    11.11.15 - NBI (me, hubby and mother)
    11.16.15 - medicals of mother @ St Lukes BGC
    11.22.15 - Lodged Visa
    11.25.15 - Frontloaded docs and requested SG CoC
    12.01.15 - CO Allocated. Request form 47a for mother
    12.02.15 - Frontloaded SG CoC (me & hubby) and form 47a
    02.09.16 - called GSM Adelaide for follow-up (71 days from CO contact)
    02.15.16 - granted! Thank you for the Blessings
    Dependent parent rejected. CO not satisfied with one of the requirements for dependency (part of household unit)
    07.28.16 - Big move! Sydney here we go!
    09.19.16 - Start of work
    09.22.16 - Hubby start of work
    06.19.17 - Hubby's new work
    11.16.17 - hello Baby!
    Jesus, I Trust In You

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

mylarosepumpupkiksauitdreamerBudsstkildaCarlosCzarengrdkGeorgeLeeHezronrecardopinoisaudiboi8988iblessycardo suberiekxiaoluCORTESJAYJLEvaristonayabrayajpearlthefishthekneelawelynneislove
Browse Members

Members Online (0) + Guest (157)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌