Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

December 2017 Visa 189/190/489/457

1444546474850»

Comments

  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    eto po details namin mga guys :)

    Visa 189
    Lodged December 4 2017
    CO Contact - May 23, 2018
    Grant June 21, 2018

    Under Agent
    Accountant (General)

    God is Good!!
  • ceasarkhoceasarkho Singapore
    Posts: 211Member
    Joined: Apr 03, 2017
    @Loknoy21, Congratulations po. God is good.

    "Faith is taking the first step even when you don't see the whole staircase." - Martin Luther King, Jr.

    Software Engineer - 261313
    Age:25+English:20+Education:15+Work Exp:10=70pts
    PTE-Academic
    29.08.17 -1st Take CS:L65/R69/S52/W78,ES:G71/OF42/P60/S90/V68/WD60
    29.09.17 - 2nd TakeCS:L48/R66/S90/W53,ES:G64/OF90/P90/S49/V73/WD90
    23.10.17 - 3rd Take CS:L79/R78/S90/W78,ES:G82/OF90/P90/S86/V76/WD90
    24.11.17 - 4th Take CS L80/R83/S90/W75,ES:G63/OF90/P90/S60/V80/WD83
    29.12.17 - 5th Take CS L75/R84/S76/W90,ES:G90/OF75/P76/S90/V71/WD90
    29.01.18 - 6th Take CS L79/R86/S90/W82,ES:G81/OF90/P90/S84/V73/WD83
    31.01.18 - Updated EOI NSW 190 75PTS
    31.01.18 - Updated EOI 189 70PTS
    02.02.18 - Received pre-invitation NSW 190
    08.02.18 - Submitted required documents to NSW190 application
    28.02.18 - SS Approved/ITA 190 NSW. Praise God!
    01.03.18 - Requested for Medical Referral letter, COC SG, NBI
    -- 28.03.18 SATA Medical appointment for the whole family.
    -- 05.03.18 NBI appointment for fingerprint.
    -- 12.03.18 SG PCC cleared
    -- 20.03.18 NBI Clearance Appointment, NBI Manila
    -- 02.04.18 NBI Clearance released -No Hit
    -- 03.04.18 - Health Declarations - All are cleared. Praise God!
    07.04.18 - Visa Lodged NSW 190.
    27.06.18 - Visa granted! Praise God!
    In God we trust! Healthy mindset makes better results.
    18.11.18 - Landed in Sydney.
    28.11.18 - Started Job

  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    ang laki ng naitulong nitong forum na to guys!! feedback works!!! maraming salamat po salahat. sa pagbibigay ng advise at comfort. u guys are all blessings from up above.

    ung feeling ko ngaun di ko pa maintindihan parang di ako makahinga.
    hahaha mamaya babanat ako ng comments :)

    @Heprex - sir maraming salamat po!!! :)
  • st_ben83st_ben83 Manila
    Posts: 47Member
    Joined: Feb 24, 2017
    Nagdilang anghel ako! Hahaha Happy for you @Loknoy21
  • clj2012clj2012 Posts: 141Member
    Joined: Aug 10, 2017
    @Loknoy21 congrats! Happy for you..

    ANZSCO Code: 221214 – Internal Auditor
    (Age:25 / Education:15 / Experience:15 / English Test:20 = 75pts)
    02 Mar 2017 - Submitted documents for skill assessment
    02 May 2017 - Received result of assessment : Positive
    13 May 2017 - Took IELTS result withheld / results received Jul 10
    10 Jul 2017 - IELTS General Exam Result: L8.5/R9.0/S7.5/W7.0
    26 Jul 2017 - Lodged EOI : PR189 - 65pts
    08 Aug 2017 - PTE A Exam : L90/R90/S86/W89
    10 Aug 2017 - Updated EOI : PR189 - 75pts
    06 Dec 2017 - ITA - PR189
    21 Dec 2017 - Lodged Visa 189 - Frontloaded docs
    28 Dec 2017 - Medical exam completed (myself / husband / daughter)
    24 May 2018 - Direct Grant yey! :) - IED: 02 August 2018
    23 Jun 2018 - IED (1 week)
    13 Dec 2018 - BM! :)

  • clj2012clj2012 Posts: 141Member
    Joined: Aug 10, 2017
    Update po natin..add nalang po yung iba na ma grant..God bless us all!

    Username | Visa type | Lodge Date | GSM Office | Date Granted | Target State/City | IED
    1. @dyanisabelle | 190 NSW | 7 Dec 2017 | Adelaide - Sarah | 16 Feb 2018 | Sydney | 27 Oct 2018
    2. @katpaz | 190 Vic | 4 Dec 2017 | Adelaide - Sarah | 15 Feb | Melbourne | 21 November 2018
    3. @audreamer05 | 190NSW | 8 Dec 2017 | Adelaide | 20 Feb 2018 | Sydney | 08 June 2018
    4. @l0ki |190 (onshore) | Dec 8 | GSM Office | March 13 2018 |
    5. @mickeymynes14 | 190| | 22 Dec 2017 | Date CO Contacted / Requested Documents | GSM
    6. @UbePandesal |190 | Dec 04 | GSM Adelaide | Mar 19 | NSW | IED - Planning (Given till 15Nov18)
    7. @vincechaos| 190 | 05 Dec 2017 | GSM Adelaide | 20 March 2018 | Sydney | 13 Dec 2018
    8. @nhaden0513 |190 NSW | December 31,2017 | GSM Adelaide | March 27, 2018 | Sydney | June 2018
    9. @ssendood | 189 | 7 Dec 2017 | Adelaide - Cynthia / 21 May 2018 | Sydney | 24 Oct 2018
    10. @ktjc | 189 | 12 Dec 2017 | GSM Office | 21 May 2018
    11. @dashboard89 | 189 | 20 December 2017 | 22 May 2018 / IED: 07 Dec 2018
    12. @nayabrayaj | 189 | 28 December 2017 | 22 May 2018
    13. @mitchiboy |189 | 31 Dec 2017 | Adelaide | 22 May 2018 | Melbourne | Oct 2018
    14. @cutsiechick21 | 489 | December 9 | Adelaide | 23 May 2018 | Adelaide | July 2018
    15. @clj2012 | 189 | December 21 | 24 May 2018 / IED 02 Aug 2018 | Sydney |
    16. @dreamer111114 |189 | Dec 6, 2017 | May 24, 2018 | Sydney | Sept 2018
    17. @caienri | 189 | December 3 | GSM Office | May 28 2018 NSW Oct 2018
    18. @jengmhyumi | 190 | 06 Dec2017/Adelaide/ 30May 2018/ NSW/ Dec 2018
    19. @Chili | 189 | Dec 5 2017 | Gsm Office | 13 June 2018 | Sydney | Dec 2018
    20. @Loknoy21 | 189 | December 4 | CO: May 23 | June 21

    ******VISA LODGE******
    Username | Visa type | Lodge Date | Date CO Contacted / Requested Documents | GSM Office
    1.

    Contacted / Requested Documents | GSM Office


    ***Invitation Received***
    Username | Visa type | Points | ANZSCO code | ITA Date Received


    *******EOI LODGE*******
    Username | Visa type | Points | ANZSCO code | EOI Lodge Date
    1. @jon1101a | 189, 190 NSW-VIC | 70, 75 | 233914 | 17 February 2017
    2. @chyrstheen | 190 NSW | 65+5 | 233311 | 6 December 2017
    3. @shylock|189/190VIC/190NSW|65+5 |233311 | 5 Dec 2017
    4. @lecia 189/190 NSW/234611 01Dec 2017
    5. @quantum |189| 75 |221111 | 14 Dec 2017

    ANZSCO Code: 221214 – Internal Auditor
    (Age:25 / Education:15 / Experience:15 / English Test:20 = 75pts)
    02 Mar 2017 - Submitted documents for skill assessment
    02 May 2017 - Received result of assessment : Positive
    13 May 2017 - Took IELTS result withheld / results received Jul 10
    10 Jul 2017 - IELTS General Exam Result: L8.5/R9.0/S7.5/W7.0
    26 Jul 2017 - Lodged EOI : PR189 - 65pts
    08 Aug 2017 - PTE A Exam : L90/R90/S86/W89
    10 Aug 2017 - Updated EOI : PR189 - 75pts
    06 Dec 2017 - ITA - PR189
    21 Dec 2017 - Lodged Visa 189 - Frontloaded docs
    28 Dec 2017 - Medical exam completed (myself / husband / daughter)
    24 May 2018 - Direct Grant yey! :) - IED: 02 August 2018
    23 Jun 2018 - IED (1 week)
    13 Dec 2018 - BM! :)

  • cutsiechick21cutsiechick21 Adelaide
    Posts: 142Member
    Joined: Nov 09, 2016
    Congrats @Loknoy21

    511112 Program or Project Administrator

    02/08/2017 - IELTS Exam: L 8.5/R8/S7/W6.5
    09/08/2017 - Submitted docs to Vetassess
    10/19/2017 - Positive assessment (4 yrs) - 5pts
    10/23/2017 - PTE Exam
    10/23/2017 - Received PTE Result: L78/R90/S86/W86
    10/27/2017 - SS EOI / SA application submitted
    11/08/2017 - SS SA ITA received
    11/28/2017 - Police COC collection
    12/09/2017 - Visa lodged
    12/23/2017 - Medical @ Point Medical SG
    12/28/2017 - Repeat urine test due to high sugar
    02/20/2018 - Immi Assessment Commence Email
    03/27/2018 - CO asked for letter of consent for employment verification
    05/23/2018 - VISA GRANT
    07/2018 - Big Move

  • gillianLeoh2017gillianLeoh2017 Philippines
    Posts: 166Member
    Joined: Dec 15, 2016
    @Loknoy21 congrats po! God is good all the time! And, all the time, God is good! :)
  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    @st_ben83 totoo sir!! :) ang saya!
  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    @clj2012 thank you po sobra!
  • lilithlilith Philippines
    Posts: 63Member
    Joined: Dec 15, 2017
    congrats @Loknoy21! praise God! :)
  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @Loknoy21 congrats! :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    San ang next thread satin guys? :) graduate na december batch im so happy :)
  • vincechaosvincechaos Sydney
    Posts: 335Member
    Joined: Nov 20, 2016

    ANZSCO 221213 External Auditor
    [VISA 190-80 pts]
    (Age:30| PTE:20| Exp: 10| Educ:15| SS:5)

    26 November 2016 - Engaged MARA accredited agent
    11 February 2017 - PTE Mock Test A: L-77 R-72 S-60 W-82
    12 February 2017 - PTE Mock Test B: L-79 R-69 S-66 W-81
    14 February 2017 - PTE-A Exam
    18 February 2017 - PTE-A Exam: L-90 R-83 S-90 W-80 (Superior)
    19 February 2017 - VETASESS Migration Assessment (Internal Auditor)
    11 April 2017 - Full skills assessment - negative outcome
    17 August 2017 - Re-assessment - outcome review (employment) - negative outcome
    15 September 2017 - CPAA Migration Assessment (External Auditor)
    09 October 2017 - Result of assessment - academically suitable for migration under External Auditor. However, duties listed in the employment are considered to be closely related to "internal auditing".
    20 October 2017 - Appeal for External Auditor (Employment)
    03 November 2017 - Positive CPAA assessment! Yehey!
    03 November 2017 - Lodged EOI (189/190-NSW)
    17 November 2017 - Received invitation to apply for NSW state nomination.
    18 November 2017 - Lodged my nomination application with NSW.
    28 November 2017 - Approved application for NSW nomination and received an ITA for Visa 190
    05 December 2017 - Lodged VISA 190 - DIBP
    09 December 2017 - Medical Examination @ Nationwide Makati
    13 December 2017 - NBI Clearance (Hit)
    18 December 2017 - Claimed NBI Clearance
    18 December 2017 - Frontloaded all documents
    21 February 2018 - CO contact - employment reference (which I have already submitted)
    23 February 2018 - First Feedback (suggestion)
    15 March 2018 - Second Feedback (suggestion)
    20 March 2018 - VISA Grant - Thank you God!
    10 September 2018 - IED
    13 December 2018 - Got a job with Big 4 Audit Firm (External Auditor-Senior Associate)
    1 July 2019 - Moved to another audit firm (External/Internal Auditor-Senior Associate)
    14 Jan 2021 - Got an Internal Auditor job in one of the biggeat insurance companies

    Tips on BM: http://pinoyau.info/discussion/6492/migrating-to-australia-with-high-hopes/p16

    For I know the plans I have for you,” declares the Lord, “plans to prosper you and not to harm you, plans to give you hope and a future. (Jeremiah 29:11)

  • PanasonicPanasonic Posts: 13Member
    Joined: Jun 22, 2018
    Hello mga kababayan dito sa Australia baka merong installer ng lift need ko ng apat
  • PanasonicPanasonic Posts: 13Member
    Joined: Jun 22, 2018
    I need it ASAP
  • onin111onin111 Cebu
    Posts: 212Member
    Joined: Apr 03, 2017
    @Loknoy21 Yehey! Ikaw na po mam... Congrats and best wishes sa next steps.. God Bless!

    ******** DG ********
    @onin111 | 189 | 12 Jan 2018 | 26 Jun 2018 | Melbourne| 25 July 2018

    -Current Status-
    DG, Planning for BM

    Application History:
    IELTS Test:
    2017/03/18 - IELTS Exam
    2017/03/31 - IELTS Results: L-7.5, R-7, W-6.5, S-8
    2017/04/11 - IELTS Enquiry on Results
    2017/06/01 - Negative IELTS Enquiry on Results

    EA Assessment:
    2017/08/08 - EA Assessment [Fast Track]
    2017/08/25 - EA Assessment Outcome: Awarded IE 233511 Prof. Eng. Skill Level 1 and Relevant Skilled Emp for 14 yrs.

    EOI 1:
    2017/08/29 - EOI 233511 - Industrial Engineer] 489 (Family Sponsored)-65, 189-55, 190-60

    PTE-A Tests:
    2017/10/24 - Applied for PTE-A Test on Nov 23
    2017/11/19 - PTE-A Mock Test A: L82/R-77/S90/W86 / G67/OF83/P90/S90/V90/WD90
    2017/11/22 - PTE-A Mock Test B: L81/R84/S90/W85 / G82/OF85/P90/S90/V90/WD90
    2017/11/23 - PTE-A Exam day
    2017/11/24 - PTE-A Results: L87/R88/S90/W84 = Superior / G90/OF90/P90/S66/V90/WD90

    EOI2:
    2017/11/24 - Filed new EOI for Visa 189 - 75 points

    ITA:
    2017/12/20 - ITA Received

    2017/12/26 - Created Immi account, Health Dec for HAP ID
    2018/01/02 - Medical Check with dependents
    2018/01/10 - Medical reports submitted by Nationwide except daughter
    2018/01/10 - Applied and paid for Visa lodging
    2018/01/12 - Uploaded all evidences, except Health
    2018/01/25 - All Health Clearance Finalised including daughter

    Grant:
    2018/06/26 - Grant by team Adelaide

  • LexiLexi Mandaluyong
    Posts: 208Member
    Joined: Sep 10, 2016
    @Loknoy21 Congrats fellow Accountant!!

    221111 Gen. Accountant
    04/13/17 - CPAA Positive Assessment
    08/2016 - 11/2017 - PTE Journey
    11/29/17 - EOI 189 - 75 pts.
    01/09/18 - EOI 190 NSW
    02/02/18 - NSW Pre-invite
    02/09/18 - Submitted NSW application
    03/22/18 - ITA/NSW Approval
    04/06/18 - Lodge Visa 190
    07/11/18 - Direct Grant (worth the wait!)

  • jengmhyumijengmhyumi Posts: 21Member
    Joined: Oct 21, 2017
    @Loknoy21 Congrats!

    Subclass 190 NSW 312111
    Visa Lodge - Dec 5, 2017
    CO Contact -Feb 27, 2018
    Grant - May 30, 2018 :)

  • ssendoodssendood Posts: 103Member
    Joined: Apr 26, 2017
    Congrats @bettyboop and @Loknoy21 :)

    221111 - Accountant (General) | Age: 30pts | English: 20pts | Experience: 10pts | Education: 15pts |Total: 75pts

    00.09.2016 - Start collating documents needed for CPAA assessment
    16.11.2016 - Requested curriculum syllabus from university
    18.11.2016 - Renewed PRC license
    19.11.2016 - Attended free seminar by Respall
    23.11.2016 - Received TOR and Certification - English as medium of instruction
    21.12.2016 - taken 20.12 booked 14.12 LRSW/77,81,67,90 (there's always a first time yey passed minimum)
    17.01.2017 - Received scanned copy of signed syllabus via email
    20.01.2017 - Requested previous employer's COE
    24.01.2017 - Received previous employer's COE (softcopy)
    26.01.2017 - Received previous employer's COE (hardcopy)
    15.03.2017 - Submitted CPAA assessment
    00.04.2017 - Joined pinoyau forum
    05.04.2017 - Received CPAA assessment - Suitable
    24.04.2017 - Submitted EOI 189 (65pts)
    26.04.2017 - taken 24.04 booked 15.04 LRSW/90,84,78,88 (short by 1pt!!!)
    19.06.2017 - missed 19.06 booked 09.05 (didn't make it to the grace period due to the elevator ppfftt still my bad)
    27.06.2017 - taken 26.06 booked 21.06 LRSW/88,79,58,90 (no voice and was coughing a lot)
    04.07.2017 - taken 03.07 booked 29.06 LRSW/74,90,83,67 (technical issues with the computer)
    08.08.2017 - taken 01.08 booked 16.07 LRSW/90,89,90,90 (finally!!!)
    08.08.2017 - Updated EOI 189 (75pts)
    16.10.2017 - INVITED!
    20.10.2017 - Medical @ St. Lukes BGC
    24.10.2017 - Renewed NBI clearance
    25.10.2017 - Medical Cleared
    07.12.2017 - Lodged Visa 189 Application - ALL except Form80 and Form1221
    24.12.2018 - Tourist for 3 weeks :)
    28.02.2018 - Attached Form80 and Form1221, updated CV, new ITR
    08.03.2018 - Notification of change in circumstances (resigned)
    08.05.2018 - Attached old passports and stamps, (since resigned) new ITR payslips COE, also COE of unclaimed points on employment
    21.05.2018 - GRANTED! YAAAY!!! 24 Oct 2018 IED
    *****AFTER GRANT*****
    04.07.2018 - CFO/PDOS
    24.08.2018 - BIG MOVE (Sydney) :)

    Waiting Game from Lodgement to Visa Grant: 165 days i.e. 5 months 14 days

    THE SUPERIOR CHALLENGE
    08.08.2017 - taken 01.08 booked 16.07 LRSW/90,89,90,90 (finally!!!)
    04.07.2017 - taken 03.07 booked 29.06 LRSW/74,90,83,67 (technical issues with the computer)
    27.06.2017 - taken 26.06 booked 21.06 LRSW/88,79,58,90 (no voice and was coughing a lot)
    19.06.2017 - missed 19.06 booked 09.05 (didn't make it to the grace period due to the elevator ppfftt still my bad)
    26.04.2017 - taken 24.04 booked 15.04 LRSW/90,84,78,88 (short by 1pt!!!)
    break
    21.12.2016 - taken 20.12 booked 14.12 LRSW/77,81,67,90 (there's always a first time yey passed minimum)

  • bettyboopbettyboop Victoria, Australia
    Posts: 146Member
    Joined: May 31, 2015
  • nayabrayajnayabrayaj Philippines
    Posts: 54Member
    Joined: Oct 10, 2016
    tahimik na tong thread natin ahhh... Goodluck sa mga mag BBM at sa lahat ng nagjojobhunt..
  • ssendoodssendood Posts: 103Member
    Joined: Apr 26, 2017
    Onga noh hahaha. Sino-sino na po mga nakapag BM? :) All the best to everyone! \:D/

    221111 - Accountant (General) | Age: 30pts | English: 20pts | Experience: 10pts | Education: 15pts |Total: 75pts

    00.09.2016 - Start collating documents needed for CPAA assessment
    16.11.2016 - Requested curriculum syllabus from university
    18.11.2016 - Renewed PRC license
    19.11.2016 - Attended free seminar by Respall
    23.11.2016 - Received TOR and Certification - English as medium of instruction
    21.12.2016 - taken 20.12 booked 14.12 LRSW/77,81,67,90 (there's always a first time yey passed minimum)
    17.01.2017 - Received scanned copy of signed syllabus via email
    20.01.2017 - Requested previous employer's COE
    24.01.2017 - Received previous employer's COE (softcopy)
    26.01.2017 - Received previous employer's COE (hardcopy)
    15.03.2017 - Submitted CPAA assessment
    00.04.2017 - Joined pinoyau forum
    05.04.2017 - Received CPAA assessment - Suitable
    24.04.2017 - Submitted EOI 189 (65pts)
    26.04.2017 - taken 24.04 booked 15.04 LRSW/90,84,78,88 (short by 1pt!!!)
    19.06.2017 - missed 19.06 booked 09.05 (didn't make it to the grace period due to the elevator ppfftt still my bad)
    27.06.2017 - taken 26.06 booked 21.06 LRSW/88,79,58,90 (no voice and was coughing a lot)
    04.07.2017 - taken 03.07 booked 29.06 LRSW/74,90,83,67 (technical issues with the computer)
    08.08.2017 - taken 01.08 booked 16.07 LRSW/90,89,90,90 (finally!!!)
    08.08.2017 - Updated EOI 189 (75pts)
    16.10.2017 - INVITED!
    20.10.2017 - Medical @ St. Lukes BGC
    24.10.2017 - Renewed NBI clearance
    25.10.2017 - Medical Cleared
    07.12.2017 - Lodged Visa 189 Application - ALL except Form80 and Form1221
    24.12.2018 - Tourist for 3 weeks :)
    28.02.2018 - Attached Form80 and Form1221, updated CV, new ITR
    08.03.2018 - Notification of change in circumstances (resigned)
    08.05.2018 - Attached old passports and stamps, (since resigned) new ITR payslips COE, also COE of unclaimed points on employment
    21.05.2018 - GRANTED! YAAAY!!! 24 Oct 2018 IED
    *****AFTER GRANT*****
    04.07.2018 - CFO/PDOS
    24.08.2018 - BIG MOVE (Sydney) :)

    Waiting Game from Lodgement to Visa Grant: 165 days i.e. 5 months 14 days

    THE SUPERIOR CHALLENGE
    08.08.2017 - taken 01.08 booked 16.07 LRSW/90,89,90,90 (finally!!!)
    04.07.2017 - taken 03.07 booked 29.06 LRSW/74,90,83,67 (technical issues with the computer)
    27.06.2017 - taken 26.06 booked 21.06 LRSW/88,79,58,90 (no voice and was coughing a lot)
    19.06.2017 - missed 19.06 booked 09.05 (didn't make it to the grace period due to the elevator ppfftt still my bad)
    26.04.2017 - taken 24.04 booked 15.04 LRSW/90,84,78,88 (short by 1pt!!!)
    break
    21.12.2016 - taken 20.12 booked 14.12 LRSW/77,81,67,90 (there's always a first time yey passed minimum)

  • dyanisabelledyanisabelle Sydney
    Posts: 210Member
    Joined: Sep 22, 2016
    Graduate na ata ang buong December batch. Hehe.

    @ssendood ako po naka BM na last May. Nagwowork na din. :) yung mga nasa Sydney na din, kita kita tayo batchmates :)

    221214 Internal Auditor : 189 - 75pts / 190 - 80pts (Age:30/Educ:15/Exp:10/English:20/SS:5)

    20/12/2016 - Submitted docs to Vetassess
    16/02/2017 - Positive assessment (4.1 yrs) - 5pts
    08/08/2017 - Live in anniversary
    04/09/2017 - PTE Take 1 : L81/R75/S45/W89
    25/09/2017 - PTE Take 2 : L83/R89/S58/W90
    04/10/2017 - PTE Take 3 : L90/R90/S90/W90 - 20pts Yay! ^_^
    06/10/2017 - Lodged EOI for 189 and 190 NSW
    20/10/2017 - ITA from NSW received (75 pts)
    21/10/2017 - Submitted application to NSW
    08/11/2017 - Updated skilled work experience - 10pts
    21/11/2017 - ITA from DIBP received 190 NSW
    07/12/2017 - Visa Lodged
    09/12/2017 - Medicals at Nationwide Manila
    14/12/2017 - Cleared medicals - de facto partner
    21/12/2017 - Cleared medicals - mine
    16/02/2018 - VISA GRANT :)

  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    @dyanisabelle wow galing po may work na agad. San thread dito tungkol sa paghahanap ng work? Hehehe mabilis lang ba? Ano po prof?
  • dyanisabelledyanisabelle Sydney
    Posts: 210Member
    Joined: Sep 22, 2016
    @Loknoy21 internal auditor po. Luckily after 2 weeks of job hunting may offer na :)

    221214 Internal Auditor : 189 - 75pts / 190 - 80pts (Age:30/Educ:15/Exp:10/English:20/SS:5)

    20/12/2016 - Submitted docs to Vetassess
    16/02/2017 - Positive assessment (4.1 yrs) - 5pts
    08/08/2017 - Live in anniversary
    04/09/2017 - PTE Take 1 : L81/R75/S45/W89
    25/09/2017 - PTE Take 2 : L83/R89/S58/W90
    04/10/2017 - PTE Take 3 : L90/R90/S90/W90 - 20pts Yay! ^_^
    06/10/2017 - Lodged EOI for 189 and 190 NSW
    20/10/2017 - ITA from NSW received (75 pts)
    21/10/2017 - Submitted application to NSW
    08/11/2017 - Updated skilled work experience - 10pts
    21/11/2017 - ITA from DIBP received 190 NSW
    07/12/2017 - Visa Lodged
    09/12/2017 - Medicals at Nationwide Manila
    14/12/2017 - Cleared medicals - de facto partner
    21/12/2017 - Cleared medicals - mine
    16/02/2018 - VISA GRANT :)

  • clj2012clj2012 Posts: 141Member
    Joined: Aug 10, 2017
    @dyanisabelle congrats! Audit firm ka or private? If I may ask Sana, San ang employer normally tumitingin ng candidates na site? Thanks

    ANZSCO Code: 221214 – Internal Auditor
    (Age:25 / Education:15 / Experience:15 / English Test:20 = 75pts)
    02 Mar 2017 - Submitted documents for skill assessment
    02 May 2017 - Received result of assessment : Positive
    13 May 2017 - Took IELTS result withheld / results received Jul 10
    10 Jul 2017 - IELTS General Exam Result: L8.5/R9.0/S7.5/W7.0
    26 Jul 2017 - Lodged EOI : PR189 - 65pts
    08 Aug 2017 - PTE A Exam : L90/R90/S86/W89
    10 Aug 2017 - Updated EOI : PR189 - 75pts
    06 Dec 2017 - ITA - PR189
    21 Dec 2017 - Lodged Visa 189 - Frontloaded docs
    28 Dec 2017 - Medical exam completed (myself / husband / daughter)
    24 May 2018 - Direct Grant yey! :) - IED: 02 August 2018
    23 Jun 2018 - IED (1 week)
    13 Dec 2018 - BM! :)

  • dyanisabelledyanisabelle Sydney
    Posts: 210Member
    Joined: Sep 22, 2016
    @clj2012 private. Sa Seek lang ako mag apply, pero advice din sakin LinkedIn :)

    221214 Internal Auditor : 189 - 75pts / 190 - 80pts (Age:30/Educ:15/Exp:10/English:20/SS:5)

    20/12/2016 - Submitted docs to Vetassess
    16/02/2017 - Positive assessment (4.1 yrs) - 5pts
    08/08/2017 - Live in anniversary
    04/09/2017 - PTE Take 1 : L81/R75/S45/W89
    25/09/2017 - PTE Take 2 : L83/R89/S58/W90
    04/10/2017 - PTE Take 3 : L90/R90/S90/W90 - 20pts Yay! ^_^
    06/10/2017 - Lodged EOI for 189 and 190 NSW
    20/10/2017 - ITA from NSW received (75 pts)
    21/10/2017 - Submitted application to NSW
    08/11/2017 - Updated skilled work experience - 10pts
    21/11/2017 - ITA from DIBP received 190 NSW
    07/12/2017 - Visa Lodged
    09/12/2017 - Medicals at Nationwide Manila
    14/12/2017 - Cleared medicals - de facto partner
    21/12/2017 - Cleared medicals - mine
    16/02/2018 - VISA GRANT :)

  • ssendoodssendood Posts: 103Member
    Joined: Apr 26, 2017
    null
    BM dn ako this August sa Syd. I'm happy for you @dyanisabelle bilis mo nakakuha! Cheers! <:-P

    221111 - Accountant (General) | Age: 30pts | English: 20pts | Experience: 10pts | Education: 15pts |Total: 75pts

    00.09.2016 - Start collating documents needed for CPAA assessment
    16.11.2016 - Requested curriculum syllabus from university
    18.11.2016 - Renewed PRC license
    19.11.2016 - Attended free seminar by Respall
    23.11.2016 - Received TOR and Certification - English as medium of instruction
    21.12.2016 - taken 20.12 booked 14.12 LRSW/77,81,67,90 (there's always a first time yey passed minimum)
    17.01.2017 - Received scanned copy of signed syllabus via email
    20.01.2017 - Requested previous employer's COE
    24.01.2017 - Received previous employer's COE (softcopy)
    26.01.2017 - Received previous employer's COE (hardcopy)
    15.03.2017 - Submitted CPAA assessment
    00.04.2017 - Joined pinoyau forum
    05.04.2017 - Received CPAA assessment - Suitable
    24.04.2017 - Submitted EOI 189 (65pts)
    26.04.2017 - taken 24.04 booked 15.04 LRSW/90,84,78,88 (short by 1pt!!!)
    19.06.2017 - missed 19.06 booked 09.05 (didn't make it to the grace period due to the elevator ppfftt still my bad)
    27.06.2017 - taken 26.06 booked 21.06 LRSW/88,79,58,90 (no voice and was coughing a lot)
    04.07.2017 - taken 03.07 booked 29.06 LRSW/74,90,83,67 (technical issues with the computer)
    08.08.2017 - taken 01.08 booked 16.07 LRSW/90,89,90,90 (finally!!!)
    08.08.2017 - Updated EOI 189 (75pts)
    16.10.2017 - INVITED!
    20.10.2017 - Medical @ St. Lukes BGC
    24.10.2017 - Renewed NBI clearance
    25.10.2017 - Medical Cleared
    07.12.2017 - Lodged Visa 189 Application - ALL except Form80 and Form1221
    24.12.2018 - Tourist for 3 weeks :)
    28.02.2018 - Attached Form80 and Form1221, updated CV, new ITR
    08.03.2018 - Notification of change in circumstances (resigned)
    08.05.2018 - Attached old passports and stamps, (since resigned) new ITR payslips COE, also COE of unclaimed points on employment
    21.05.2018 - GRANTED! YAAAY!!! 24 Oct 2018 IED
    *****AFTER GRANT*****
    04.07.2018 - CFO/PDOS
    24.08.2018 - BIG MOVE (Sydney) :)

    Waiting Game from Lodgement to Visa Grant: 165 days i.e. 5 months 14 days

    THE SUPERIOR CHALLENGE
    08.08.2017 - taken 01.08 booked 16.07 LRSW/90,89,90,90 (finally!!!)
    04.07.2017 - taken 03.07 booked 29.06 LRSW/74,90,83,67 (technical issues with the computer)
    27.06.2017 - taken 26.06 booked 21.06 LRSW/88,79,58,90 (no voice and was coughing a lot)
    19.06.2017 - missed 19.06 booked 09.05 (didn't make it to the grace period due to the elevator ppfftt still my bad)
    26.04.2017 - taken 24.04 booked 15.04 LRSW/90,84,78,88 (short by 1pt!!!)
    break
    21.12.2016 - taken 20.12 booked 14.12 LRSW/77,81,67,90 (there's always a first time yey passed minimum)

  • nayabrayajnayabrayaj Philippines
    Posts: 54Member
    Joined: Oct 10, 2016
    congrats @dyanisabelle.. tinde non, 2wks lang JO na.. By Sept naman ako mag BM, takits tayo jan sa Syd soon...
Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

jmyymhickarnKlausMetzgDanielle60DarellBostemmnlldllbumblebimsadikmacjen.gatchHOPING2018mastersifuzindylittlemissarchiGenaGerstaReubenRandbluerainpatcwdesignermaryannkentrodriguezAdelainetormis
Browse Members

Members Online (0) + Guest (111)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌