Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

Skilled Migrant Regional Visa (489) Application

11011131516

Comments

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @kh@L3L I think pwede ka na mag feedback since naka 3 months ka na..

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    @Hunter_08 cge try ko mag feedback....pero ano kaya magandang reason/statement sa feedback ko?

    May idea ka sir? pa share naman po pls

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    nakita ko 7-9 months na pala processing time sa 489....antay na lng ako...

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @kh@L3L siguro try mo lang is mag suggest ka na sana lagyan nila ng stages yung application kasi "received","grant" or " CO contact" lang ang mostly na status ng application sana lagyan din nila kung na rereview/proprocess na yung application mismo para alam mo kung ano nangyayari sa application mo.. tapos isingit mo na sa ibaba na kung pwede ipa check yung visa application mo at ilagay mo details.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    Hunter_08 said:

    @kh@L3L siguro try mo lang is mag suggest ka na sana lagyan nila ng stages yung application kasi "received","grant" or " CO contact" lang ang mostly na status ng application sana lagyan din nila kung na rereview/proprocess na yung application mismo para alam mo kung ano nangyayari sa application mo.. tapos isingit mo na sa ibaba na kung pwede ipa check yung visa application mo at ilagay mo details.

    ayos to sir!!!!
    maraming salamat.....gets ko ang point ng feedback mo...try ko mag feedback by next week...

    maraming salamat sir :)

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011
    @kh@L3L 489 ng anong state. FS or SS?

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    TY Lord!
    granted napo visa ko.... TY Lord at sa lahat dito sa forum....

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    @batman
    batman said:

    @kh@L3L 489 ng anong state. FS or SS?

    SA po state ko sir :)

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • its.kcits.kc Posts: 116Member
    Joined: May 11, 2018
    kh@L3L said:

    TY Lord!
    granted napo visa ko.... TY Lord at sa lahat dito sa forum....

    Congrats po ano pong occupation niyo sa SA?

    261313 | Software Engineer | SC189 | Lodge Date 20 Sep 2018 | Grant 11 Dec 2018

  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011
    @kh@L3L congrats buti 3 months waiting lang. sana ako din ganun lang katagal.

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • jomar011888jomar011888 Philippines
    Posts: 351Member
    Joined: Jun 10, 2017
    @kh@L3L wow congratz po. sana ako makareceive naman iTA 489 dec 4 ako nagsubmit eoi. actually i was invited na po last oct 4 pero nagexpired po ung ItA due to insufficient funds kaya eto antay nanaman ready na lahat ng docsnko pati lodging fees ItA nalang po waiting 65pts po including FS points sa victoria po. Congratz ulit
  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    @kh@L3L congrats sir!

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    its.kc said:

    kh@L3L said:

    TY Lord!
    granted napo visa ko.... TY Lord at sa lahat dito sa forum....

    Congrats po ano pong occupation niyo sa SA?
    Ty po, software tester ang sa ACS ko, pero tumatanggap din ako ng labada, car wash, baby sitter, etc hehehe :)

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    batman said:

    @kh@L3L congrats buti 3 months waiting lang. sana ako din ganun lang katagal.

    ty boss, darating din yan boss, antay2x lng :)

    Lurker lng ako sa forum pero malaking pasalamat ako sa inyo kasi mabubuti kaung tao at tumutulong kau sa mga tulad kong DIY at sa forum lng din nka tambay :)

    salamat ulit :)

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    Heprex said:

    @kh@L3L congrats sir!

    boss salamat sa inyo, lurker lng ako pero palagi akong nag ba.basa sa mga posts mo :)
    laking tulong mga advises nyo....

    kahapon ng umaga nka draft na ako ng feedback form pra ready e submit sana ngaun, pero around 3 PM na grant na visa, so hindi na ako na member ng team #feedback :)

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    edited June 2018
    @jomar011888 ty po boss :)
    na denied din ako sa VIC kaya nag 489-SA ako :)

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • its.kcits.kc Posts: 116Member
    Joined: May 11, 2018
    kh@L3L said:

    its.kc said:

    kh@L3L said:

    TY Lord!
    granted napo visa ko.... TY Lord at sa lahat dito sa forum....

    Congrats po ano pong occupation niyo sa SA?
    Ty po, software tester ang sa ACS ko, pero tumatanggap din ako ng labada, car wash, baby sitter, etc hehehe :)
    Hahaha! Ilan po points niyo nung nainvite kayo?

    261313 | Software Engineer | SC189 | Lodge Date 20 Sep 2018 | Grant 11 Dec 2018

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    @its.kc 80 po points ko boss :)
    na balitaan ko ang 489 tumaas na points

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • its.kcits.kc Posts: 116Member
    Joined: May 11, 2018
    @kh@L3L opo, 90 points na :( salamat po sa info

    261313 | Software Engineer | SC189 | Lodge Date 20 Sep 2018 | Grant 11 Dec 2018

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    @its.kc grabe ang taas na pala ngaun

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • JapsRNJapsRN Philippines
    Posts: 97Member
    Joined: Jan 25, 2017
    Hello, sino po naka 489 family sponsored dito? Ask lang po ng timeline nyo. TIA
  • jomar011888jomar011888 Philippines
    Posts: 351Member
    Joined: Jun 10, 2017
    @JapsRN ako po sep 26 2017 naglodge 489 FS tapos nakareceived ako ITA Oct 4 with 65pts po including FS points. kaso nagexpired nung dec 3 due to insufficient funds. dec 4 resubmit po ako pero until mow wala pa ako invite.

    matatapos na ang fiscal year sana sa next round ay makareceive na po
  • JapsRNJapsRN Philippines
    Posts: 97Member
    Joined: Jan 25, 2017
    @jomar011888 ah I see, saan state po yung senyo? Hope mainvite na po uli kayo. Plan ko din yung FS489 sa qld naman po. Abot naman ako sa points kaya lng maexpire student visa ko sa march and by nov pa ko makakapag skill assesssment and after pa nun makapag sumbit EOI, di ko alam f aabot visa ko para di na uwi sa pinas
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @kh@L3L congrats.. kelan BM mo?

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    edited June 2018
    @Hunter_08 salamat boss....
    sa july 21 na BM ko :)
    kau boss kelan BM nyo?

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @kh@L3L july 3 sir

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017
    @Hunter_08 ayos yan sir :)
    pero bakasyon muna kami ng 1 week sa melby tapos straight to Adelaide na :)

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • cutsiechick21cutsiechick21 Adelaide
    Posts: 142Member
    Joined: Nov 09, 2016
    hello @Hunter_08 @kh@L3L BM na din kami sa Jul 30.. nagairbnb kau?

    511112 Program or Project Administrator

    02/08/2017 - IELTS Exam: L 8.5/R8/S7/W6.5
    09/08/2017 - Submitted docs to Vetassess
    10/19/2017 - Positive assessment (4 yrs) - 5pts
    10/23/2017 - PTE Exam
    10/23/2017 - Received PTE Result: L78/R90/S86/W86
    10/27/2017 - SS EOI / SA application submitted
    11/08/2017 - SS SA ITA received
    11/28/2017 - Police COC collection
    12/09/2017 - Visa lodged
    12/23/2017 - Medical @ Point Medical SG
    12/28/2017 - Repeat urine test due to high sugar
    02/20/2018 - Immi Assessment Commence Email
    03/27/2018 - CO asked for letter of consent for employment verification
    05/23/2018 - VISA GRANT
    07/2018 - Big Move

  • kh@L3Lkh@L3L Adelaide
    Posts: 125Member
    Joined: Jun 06, 2017

    hello @Hunter_08 @kh@L3L BM na din kami sa Jul 30.. nagairbnb kau?

    woi ayos yan sa Adelaide ka rin pala boss :)
    nag rent lng kami ng room while mag hahanap ng bahay

    261314 (Software Tester)
    June 2017 ------Doc Collection
    July-1-2017 ----ACS Assessment
    Sept-11-2017 --Skill Assessed suitable
    Sept-28-2017 --PTE 1 L77-R79-S59-W77
    Oct-10-2017 ---PTE 2 L66-R66-S49-W73
    Nov-6-2017 ----PTE 3 Exam
    Nov-15-2017 ---PTE 3 Result L82-R84-S90-W80
    Nov-16-2017 ---Visa 190 EOI Submitted (VIC)
    Nov-17-2017 ---State Invitation To Apply (VIC)
    Nov-19-2017 ---State Application Submitted (VIC)
    Jan-10-2018 ---Visa 190 State Application Denied (VIC)
    Jan-11-2018 --- Visa 489 State Application Submitted (SA)
    Feb-5-2018 --- State Invitation Approved (SA)
    Feb-23-2018 ---Visa 489 Lodged (SA)
    Jun-5-2018 ---- Direct Grant...TYVM GOD!!!!
    July-21-2018 -- Big Move (May God Bless and Guide Us)

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @kh@L3L @cutsiechick21 @Hunter_08 Hello. Update naman kayo dito sa experiences nyo sa BM sa adelaide ha. Si hubby ko nman mauuna muna sa amin sa Aug 4 alis nya. Kami ng kids sa Dec pa. Excited na kami na medyo kinakabahan kasi apply ulit ng work. Sana makahanap tayo agad ng trabaho. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

geecosemijormonErikaMatavirgobabyElmerson14redculturevulturearkigraceorbitakingisfromphhael17moonytrxmaikzxperezjecillevmalicdempayterwynpayterwyn_007kimpz0701HowardElerbjayallenb_sydneykbadmd
Browse Members

Members Online (0) + Guest (167)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌