Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

December 2017 Visa 189/190/489/457

14445474950

Comments

  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    @kaidenMVH nice!! Salamat sir! Ang concern ko talag un maternity benefits eh. Baka sakali biyayaan ni lord tapos mag leave without pay tuloy kasi di pa entitled :(
  • kaidenMVHkaidenMVH Sydney
    Posts: 916Member
    Joined: Feb 02, 2016
    edited May 2018
    @Loknoy21 yun lang din sir nakita ko na magiging affected tayo, if balak kaagad natin mag karoon ng baby pagdating sa Oz. Kami kasi stop na hehe. anyway sir lapit na yan sa inyo, kunting intay na lang di na yan aabutin ng July 1.

    312111 Architectural Draftsperson 80pts 190 NSW
    04/Apr/2017 VETASSES
    11/Jul/2017 VETASSES+
    Waiting for States to open.......
    26/Sep/2017 NSW open for 312111
    29/Sep/2017 PTE exam
    01/Oct/2017 PTE Result L85, R83, S79, W80
    02/Oct/2017 EOI 190 NSW
    20/Oct/2017 Pre Invite 190 NSW
    30/Oct/2017 SS Application 190 NSW
    21/Dec/2017 SS Approved/ITA 190 NSW
    20/Jan/2018 health exam, me and eldest son
    22/Jan/2018 eldest son mantoux TB test
    (no stock at SATA AMK on 20/Jan!)

    23/Jan/2018 health clearance (me)
    25/Jan/2018 health clearance (5 yr old son)
    29/Jan/2018 Singapore Police Force COC (me)
    03/Feb/2018 health clearance (youngest son)
    06/Feb/2018 Singapore Police Force COC (wife)
    06/Feb/2018 health clearance (wife)
    08/Feb/2018 Visa lodge! So help me God :-)
    29/May/2018 CO contact (PH PCC)
    05/Sep/2018 Golden Email! Thank you Lord!

    Romans 12:12 Rejoice in hope, be patient in tribulation, be constant in prayer.

    James 5:7-8 Be patient, therefore, brothers, until the coming of the Lord. See how the farmer waits for the precious fruit of the earth, being patient about it, until it receives the early and the late rains. You also, be patient. Establish your hearts, for the coming of the Lord is at hand.

    Proverbs 3:5-6 Trust in the LORD with all your heart, and do not lean on your own understanding. In all your ways acknowledge him, and he will make straight your paths.

    Onward to the next chapter!

  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    @kaidenMVH sananga sir. Hehe ako pa naman un manganganak kung sakali. Hahahaha :) si lord na bahala nito. Kami kasi isa pa lng di na pwede antayin ang 4 yrs kasi may taning din sa age hehe
  • kaidenMVHkaidenMVH Sydney
    Posts: 916Member
    Joined: Feb 02, 2016
    @Loknoy21 ay sorry haha, ma'am pala. lapit na po yan, di na aabot ng July 1. good luck po sa application.

    312111 Architectural Draftsperson 80pts 190 NSW
    04/Apr/2017 VETASSES
    11/Jul/2017 VETASSES+
    Waiting for States to open.......
    26/Sep/2017 NSW open for 312111
    29/Sep/2017 PTE exam
    01/Oct/2017 PTE Result L85, R83, S79, W80
    02/Oct/2017 EOI 190 NSW
    20/Oct/2017 Pre Invite 190 NSW
    30/Oct/2017 SS Application 190 NSW
    21/Dec/2017 SS Approved/ITA 190 NSW
    20/Jan/2018 health exam, me and eldest son
    22/Jan/2018 eldest son mantoux TB test
    (no stock at SATA AMK on 20/Jan!)

    23/Jan/2018 health clearance (me)
    25/Jan/2018 health clearance (5 yr old son)
    29/Jan/2018 Singapore Police Force COC (me)
    03/Feb/2018 health clearance (youngest son)
    06/Feb/2018 Singapore Police Force COC (wife)
    06/Feb/2018 health clearance (wife)
    08/Feb/2018 Visa lodge! So help me God :-)
    29/May/2018 CO contact (PH PCC)
    05/Sep/2018 Golden Email! Thank you Lord!

    Romans 12:12 Rejoice in hope, be patient in tribulation, be constant in prayer.

    James 5:7-8 Be patient, therefore, brothers, until the coming of the Lord. See how the farmer waits for the precious fruit of the earth, being patient about it, until it receives the early and the late rains. You also, be patient. Establish your hearts, for the coming of the Lord is at hand.

    Proverbs 3:5-6 Trust in the LORD with all your heart, and do not lean on your own understanding. In all your ways acknowledge him, and he will make straight your paths.

    Onward to the next chapter!

  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    @kaidenMVH salamat sir. Praying for all of us too! Kaya naten ere!!!
  • jengmhyumijengmhyumi Posts: 21Member
    Joined: Oct 21, 2017
    Glory be to God! Guys we are happy to update the group that we have been granted finally! We wish the best to all. This is an answered prayer just in time... in His time.

    Subclass 190 NSW 312111
    Visa Lodge - Dec 5, 2017
    CO Contact -Feb 27, 2018
    Grant - May 30, 2018 :)

  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    @jengmhyumi wow!!! God is good ! Congrats po!
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @jengmhyumi congrats

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • st_ben83st_ben83 Manila
    Posts: 47Member
    Joined: Feb 24, 2017
  • kaidenMVHkaidenMVH Sydney
    Posts: 916Member
    Joined: Feb 02, 2016
    @jengmhyumi congrats!

    312111 Architectural Draftsperson 80pts 190 NSW
    04/Apr/2017 VETASSES
    11/Jul/2017 VETASSES+
    Waiting for States to open.......
    26/Sep/2017 NSW open for 312111
    29/Sep/2017 PTE exam
    01/Oct/2017 PTE Result L85, R83, S79, W80
    02/Oct/2017 EOI 190 NSW
    20/Oct/2017 Pre Invite 190 NSW
    30/Oct/2017 SS Application 190 NSW
    21/Dec/2017 SS Approved/ITA 190 NSW
    20/Jan/2018 health exam, me and eldest son
    22/Jan/2018 eldest son mantoux TB test
    (no stock at SATA AMK on 20/Jan!)

    23/Jan/2018 health clearance (me)
    25/Jan/2018 health clearance (5 yr old son)
    29/Jan/2018 Singapore Police Force COC (me)
    03/Feb/2018 health clearance (youngest son)
    06/Feb/2018 Singapore Police Force COC (wife)
    06/Feb/2018 health clearance (wife)
    08/Feb/2018 Visa lodge! So help me God :-)
    29/May/2018 CO contact (PH PCC)
    05/Sep/2018 Golden Email! Thank you Lord!

    Romans 12:12 Rejoice in hope, be patient in tribulation, be constant in prayer.

    James 5:7-8 Be patient, therefore, brothers, until the coming of the Lord. See how the farmer waits for the precious fruit of the earth, being patient about it, until it receives the early and the late rains. You also, be patient. Establish your hearts, for the coming of the Lord is at hand.

    Proverbs 3:5-6 Trust in the LORD with all your heart, and do not lean on your own understanding. In all your ways acknowledge him, and he will make straight your paths.

    Onward to the next chapter!

  • JwadeJwade Singapore
    Posts: 141Member
    Joined: Feb 07, 2018
    Loknoy21 said:

    @st_ben83 :( nakaka sad lang talaga. Kasi habol namin di ma affext ng changes sa benefit by July 1 :( dun sa paternal leave scheme :(

    Hi @Loknoy21 ano ung benefit n un?
  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    @Jwade un maternity pay po with leave around 5 mos ata dun as per initial readings ko tapos may weekly allowance while on maternity .
  • ssendoodssendood Posts: 103Member
    Joined: Apr 26, 2017
    Congrats @jengmhyumi

    221111 - Accountant (General) | Age: 30pts | English: 20pts | Experience: 10pts | Education: 15pts |Total: 75pts

    00.09.2016 - Start collating documents needed for CPAA assessment
    16.11.2016 - Requested curriculum syllabus from university
    18.11.2016 - Renewed PRC license
    19.11.2016 - Attended free seminar by Respall
    23.11.2016 - Received TOR and Certification - English as medium of instruction
    21.12.2016 - taken 20.12 booked 14.12 LRSW/77,81,67,90 (there's always a first time yey passed minimum)
    17.01.2017 - Received scanned copy of signed syllabus via email
    20.01.2017 - Requested previous employer's COE
    24.01.2017 - Received previous employer's COE (softcopy)
    26.01.2017 - Received previous employer's COE (hardcopy)
    15.03.2017 - Submitted CPAA assessment
    00.04.2017 - Joined pinoyau forum
    05.04.2017 - Received CPAA assessment - Suitable
    24.04.2017 - Submitted EOI 189 (65pts)
    26.04.2017 - taken 24.04 booked 15.04 LRSW/90,84,78,88 (short by 1pt!!!)
    19.06.2017 - missed 19.06 booked 09.05 (didn't make it to the grace period due to the elevator ppfftt still my bad)
    27.06.2017 - taken 26.06 booked 21.06 LRSW/88,79,58,90 (no voice and was coughing a lot)
    04.07.2017 - taken 03.07 booked 29.06 LRSW/74,90,83,67 (technical issues with the computer)
    08.08.2017 - taken 01.08 booked 16.07 LRSW/90,89,90,90 (finally!!!)
    08.08.2017 - Updated EOI 189 (75pts)
    16.10.2017 - INVITED!
    20.10.2017 - Medical @ St. Lukes BGC
    24.10.2017 - Renewed NBI clearance
    25.10.2017 - Medical Cleared
    07.12.2017 - Lodged Visa 189 Application - ALL except Form80 and Form1221
    24.12.2018 - Tourist for 3 weeks :)
    28.02.2018 - Attached Form80 and Form1221, updated CV, new ITR
    08.03.2018 - Notification of change in circumstances (resigned)
    08.05.2018 - Attached old passports and stamps, (since resigned) new ITR payslips COE, also COE of unclaimed points on employment
    21.05.2018 - GRANTED! YAAAY!!! 24 Oct 2018 IED
    *****AFTER GRANT*****
    04.07.2018 - CFO/PDOS
    24.08.2018 - BIG MOVE (Sydney) :)

    Waiting Game from Lodgement to Visa Grant: 165 days i.e. 5 months 14 days

    THE SUPERIOR CHALLENGE
    08.08.2017 - taken 01.08 booked 16.07 LRSW/90,89,90,90 (finally!!!)
    04.07.2017 - taken 03.07 booked 29.06 LRSW/74,90,83,67 (technical issues with the computer)
    27.06.2017 - taken 26.06 booked 21.06 LRSW/88,79,58,90 (no voice and was coughing a lot)
    19.06.2017 - missed 19.06 booked 09.05 (didn't make it to the grace period due to the elevator ppfftt still my bad)
    26.04.2017 - taken 24.04 booked 15.04 LRSW/90,84,78,88 (short by 1pt!!!)
    break
    21.12.2016 - taken 20.12 booked 14.12 LRSW/77,81,67,90 (there's always a first time yey passed minimum)

  • jengmhyumijengmhyumi Posts: 21Member
    Joined: Oct 21, 2017
    Salamat sa lahat

    Subclass 190 NSW 312111
    Visa Lodge - Dec 5, 2017
    CO Contact -Feb 27, 2018
    Grant - May 30, 2018 :)

  • onin111onin111 Cebu
    Posts: 212Member
    Joined: Apr 03, 2017
    @jengmhyumi Wow Congrats!

    @Loknoy21 Wag po mag alala mam, basta feedback lang po para ma push pa rin kahit papano. Tapos yung 815, if during medical nyo is walang mga repeat tests, usually ok na yun at hindi naman kase hiningi sa CO ngayun, so parang wala issue talaga

    ******** DG ********
    @onin111 | 189 | 12 Jan 2018 | 26 Jun 2018 | Melbourne| 25 July 2018

    -Current Status-
    DG, Planning for BM

    Application History:
    IELTS Test:
    2017/03/18 - IELTS Exam
    2017/03/31 - IELTS Results: L-7.5, R-7, W-6.5, S-8
    2017/04/11 - IELTS Enquiry on Results
    2017/06/01 - Negative IELTS Enquiry on Results

    EA Assessment:
    2017/08/08 - EA Assessment [Fast Track]
    2017/08/25 - EA Assessment Outcome: Awarded IE 233511 Prof. Eng. Skill Level 1 and Relevant Skilled Emp for 14 yrs.

    EOI 1:
    2017/08/29 - EOI 233511 - Industrial Engineer] 489 (Family Sponsored)-65, 189-55, 190-60

    PTE-A Tests:
    2017/10/24 - Applied for PTE-A Test on Nov 23
    2017/11/19 - PTE-A Mock Test A: L82/R-77/S90/W86 / G67/OF83/P90/S90/V90/WD90
    2017/11/22 - PTE-A Mock Test B: L81/R84/S90/W85 / G82/OF85/P90/S90/V90/WD90
    2017/11/23 - PTE-A Exam day
    2017/11/24 - PTE-A Results: L87/R88/S90/W84 = Superior / G90/OF90/P90/S66/V90/WD90

    EOI2:
    2017/11/24 - Filed new EOI for Visa 189 - 75 points

    ITA:
    2017/12/20 - ITA Received

    2017/12/26 - Created Immi account, Health Dec for HAP ID
    2018/01/02 - Medical Check with dependents
    2018/01/10 - Medical reports submitted by Nationwide except daughter
    2018/01/10 - Applied and paid for Visa lodging
    2018/01/12 - Uploaded all evidences, except Health
    2018/01/25 - All Health Clearance Finalised including daughter

    Grant:
    2018/06/26 - Grant by team Adelaide

  • onin111onin111 Cebu
    Posts: 212Member
    Joined: Apr 03, 2017
    @Loknoy21
    Exempted sa waiting rules ka pa la mam if manganganak ka between the new fiscal year:
    -Temporary partner and permanent visa holders who have a baby born between 1 July 2018 and 31 December 2018, and are otherwise eligible for Parental Leave Pay or Dad and Partner Pay, will still be able to access these payments for that baby.

    ******** DG ********
    @onin111 | 189 | 12 Jan 2018 | 26 Jun 2018 | Melbourne| 25 July 2018

    -Current Status-
    DG, Planning for BM

    Application History:
    IELTS Test:
    2017/03/18 - IELTS Exam
    2017/03/31 - IELTS Results: L-7.5, R-7, W-6.5, S-8
    2017/04/11 - IELTS Enquiry on Results
    2017/06/01 - Negative IELTS Enquiry on Results

    EA Assessment:
    2017/08/08 - EA Assessment [Fast Track]
    2017/08/25 - EA Assessment Outcome: Awarded IE 233511 Prof. Eng. Skill Level 1 and Relevant Skilled Emp for 14 yrs.

    EOI 1:
    2017/08/29 - EOI 233511 - Industrial Engineer] 489 (Family Sponsored)-65, 189-55, 190-60

    PTE-A Tests:
    2017/10/24 - Applied for PTE-A Test on Nov 23
    2017/11/19 - PTE-A Mock Test A: L82/R-77/S90/W86 / G67/OF83/P90/S90/V90/WD90
    2017/11/22 - PTE-A Mock Test B: L81/R84/S90/W85 / G82/OF85/P90/S90/V90/WD90
    2017/11/23 - PTE-A Exam day
    2017/11/24 - PTE-A Results: L87/R88/S90/W84 = Superior / G90/OF90/P90/S66/V90/WD90

    EOI2:
    2017/11/24 - Filed new EOI for Visa 189 - 75 points

    ITA:
    2017/12/20 - ITA Received

    2017/12/26 - Created Immi account, Health Dec for HAP ID
    2018/01/02 - Medical Check with dependents
    2018/01/10 - Medical reports submitted by Nationwide except daughter
    2018/01/10 - Applied and paid for Visa lodging
    2018/01/12 - Uploaded all evidences, except Health
    2018/01/25 - All Health Clearance Finalised including daughter

    Grant:
    2018/06/26 - Grant by team Adelaide

  • carlo77carlo77 Posts: 118Member
    Joined: Aug 06, 2017
    edited May 2018
    Hello Guys,

    Got our grant today! Salamat talaga sa mga tulong nyo! Thanks God!

    Below is my timeline:

    Subclass 190 - Developer/Programmer
    Visa lodged: Dec 12, 2017
    Immi Commence Email: Feb 28, 2018
    Visa Grant: May 30, 2018
    Initial Entry: October 19, 2018

    Subclass 190 - Developer/Programmer
    Visa lodged: Dec 12, 2017
    Immi Commence Email: Feb 28, 2018
    Visa Grant: May 30, 2018
    Initial Entry: October 19, 2018

    And Jesus looking upon them saith, With men it is impossible, but not with God: for with God all things are possible. - Mark 10:27

  • jengmhyumijengmhyumi Posts: 21Member
    Joined: Oct 21, 2017
    @carlo77 Congrats!

    Subclass 190 NSW 312111
    Visa Lodge - Dec 5, 2017
    CO Contact -Feb 27, 2018
    Grant - May 30, 2018 :)

  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    @onin111 haha nagpplan pa lang po sana kami next year eh. Hehehe push nalang ng grant ng before july 1. Ano kaya pwedeng feedback sir? Suggestion lanb? Kaka suggest ko lanh last week eh /(
  • carlo77carlo77 Posts: 118Member
    Joined: Aug 06, 2017
    salamat @jengmhyumi! :)

    Subclass 190 - Developer/Programmer
    Visa lodged: Dec 12, 2017
    Immi Commence Email: Feb 28, 2018
    Visa Grant: May 30, 2018
    Initial Entry: October 19, 2018

    And Jesus looking upon them saith, With men it is impossible, but not with God: for with God all things are possible. - Mark 10:27

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @carlo77 congrats pre.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • carlo77carlo77 Posts: 118Member
    Joined: Aug 06, 2017
    pre @Hunter_08 sa wakas nakuha ko rin! salamat pala sa tulong mo! :)

    Subclass 190 - Developer/Programmer
    Visa lodged: Dec 12, 2017
    Immi Commence Email: Feb 28, 2018
    Visa Grant: May 30, 2018
    Initial Entry: October 19, 2018

    And Jesus looking upon them saith, With men it is impossible, but not with God: for with God all things are possible. - Mark 10:27

  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    @carlo77 congrats po!
  • carlo77carlo77 Posts: 118Member
    Joined: Aug 06, 2017
    maraming salamat @Loknoy21!

    Subclass 190 - Developer/Programmer
    Visa lodged: Dec 12, 2017
    Immi Commence Email: Feb 28, 2018
    Visa Grant: May 30, 2018
    Initial Entry: October 19, 2018

    And Jesus looking upon them saith, With men it is impossible, but not with God: for with God all things are possible. - Mark 10:27

  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    @carlo77 congratsss

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • carlo77carlo77 Posts: 118Member
    Joined: Aug 06, 2017
    edited May 2018
    salamat @Heprex! after grant may thread ba tayo anong next step? like mga preparations, CFO and etc.. thanks :)

    Subclass 190 - Developer/Programmer
    Visa lodged: Dec 12, 2017
    Immi Commence Email: Feb 28, 2018
    Visa Grant: May 30, 2018
    Initial Entry: October 19, 2018

    And Jesus looking upon them saith, With men it is impossible, but not with God: for with God all things are possible. - Mark 10:27

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @carlo77 congrats! :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • carlo77carlo77 Posts: 118Member
    Joined: Aug 06, 2017
    salamat @chococrinkle and @Heprex! hehehe :)

    Subclass 190 - Developer/Programmer
    Visa lodged: Dec 12, 2017
    Immi Commence Email: Feb 28, 2018
    Visa Grant: May 30, 2018
    Initial Entry: October 19, 2018

    And Jesus looking upon them saith, With men it is impossible, but not with God: for with God all things are possible. - Mark 10:27

  • agdagd Singapore
    Posts: 773Member
    Joined: Jun 12, 2017
    @jengmhyumi congrats! :)

    261312 Developer Programmer - (English - 20pts | Age - 30pts. | Qualification - 10 | Experience - 0 ) = 60pts.

    Subclass 189 - 60pts.
    Subclass 190 - (60 + 5 spouse points + 5 SN) = 70pts.

    08/04/2016 - Took IELTS - L/R/W/S - 6.5/7/6.5/7 - Competent
    05/17/2017 - PTE Mock A - L/R/W/S - 74/62/66/76
    05/19/2017 - PTE Mock B - L/R/W/S - 76/70/72/89
    05/30/2017 - PTE Take 1 - L/R/W/S - 79/75/78/78 - Proficient
    06/06/2017 - PTE Take 2 - L/R/W/S - 82/87/90/88- Superior - Thank you, Lord! :)

    PTE Tips: http://pinoyau.info/discussion/4233/pte-academic/p465#Comment_245887

    06/14/2017 - Collection of docs for ACS Assessment
    06/21/2017 - Submitted ACS Assessment
    08/14/2017 - ACS Result Positive. Equivalent to AQF Associate Degree. 5 years experience deducted.
    08/15/2017 - Gathering docs for spouse points (VETASSESS)
    08/22/2017 - Lodged spouse's VETASSESS
    10/05/2017 - VETASSESS results positive - aquired 5pts. for 190
    10/07/2017 - Submitted EOI - 189, 190-NSW, 190-VIC
    10/20/2017 - ITA NSW Received!
    10/22/2017 - Submitted NSW Application
    11/28/2017 - NSW SS Approved! Received ITA for visa 190

    ---------------Gathering docs for visa lodge---------------

    -------------------- Christmas Break --------------------

    01-19-2018 - Visa lodge, SG eAppeal
    01-23-2018 - SG eAppeal Approved
    01-25-2018 - Wife's SG eAppeal Approved
    02-03-2018 - Medical - wife and me
    02-05-2018 - Medical - kids
    02-08-2018 - Medical - Daughter - IGRA
    02-14-2018 - Form 815 Health Undertaking for daughter
    04-27-2018 - 1st CO Contact: Parental Consent/Form 1229
    05-22-2018 - 2nd CO Contact: Wife's Statutory Declaration
    08-21-2018 - 3rd CO Contact: Repeat Medical - Daughter
    09-21-2018 - VISA GRANT! Thank you Lord!

    11-11-2018 - IE (Medicare, Centrelink, NSW DL)
    April 2019 - Target BM with wife
    January 2020 - Target BM - 3 kids

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

jmyymhickarnKlausMetzgDanielle60DarellBostemmnlldllbumblebimsadikmacjen.gatchHOPING2018mastersifuzindylittlemissarchiGenaGerstaReubenRandbluerainpatcwdesignermaryannkentrodriguezAdelainetormis
Browse Members

Members Online (0) + Guest (120)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌