Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

Case Officer (CO) Contact Thread

15859616364129

Comments

  • OZingwithOZomenessOZingwithOZomeness Kung Saan ang Lahat gusto pumunta sa forum na ito, so alam niyo na yun.
    Posts: 543Member
    Joined: Oct 20, 2017
    @marimari congrats sayo.
  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    @marimari ahahah employee of the month na siguro yan sa dami ng compliments. ahahaha

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @marimari congrats

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • EGMS_AU2017EGMS_AU2017 Singapore
    Posts: 439Member
    Joined: Sep 19, 2017
    @marimari congrats anu timeline mo
  • pahpuhpahpuh Australia
    Posts: 106Member
    Joined: Oct 06, 2017
    @marimari congrats! :)

    233411 - Electronics Engineer | Age: 30pts | Education: 15pts | Experience: 10pts | English: 20pts | Total: 75pts

    5-25-2017 - IELTS examination
    7-26-2017 - CDR assessment EA
    8-15-2017 - EA Assessment result
    9-28-2017 - PTE-A exam
    9-30-2017 - submit EOI 189
    10-4-2017 - Invitation
    11-9-2017 - VISA Lodge
    30-1-2018 - CO contact
    21-2-2018 - Send Feedback
    22-2-2018 - Visa Grant :)

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @marimari congrats!

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • Loknoy21Loknoy21 Manila
    Posts: 288Member
    Joined: Jan 30, 2018
    @marimari wow congrats po
  • mespedidomespedido Singapore
    Posts: 302Member
    Joined: Aug 02, 2017
    Isang napakahandang umaga para sa akin at sa aking pamilya! VISA 189 GRANTED!!!!! Family of 3!!! Maraming Maraming Salamat Lord!!!!!!
  • hi pohi po singapore
    Posts: 46Member
    Joined: Mar 01, 2017
    @marimari Congratulations po.
  • hi pohi po singapore
    Posts: 46Member
    Joined: Mar 01, 2017
    @mespedido Congratulations mam!
  • EGMS_AU2017EGMS_AU2017 Singapore
    Posts: 439Member
    Joined: Sep 19, 2017
    @mespedido wow congrats!!!!
  • jjjjjjjj United Arab Emirates
    Posts: 28Member
    Joined: Jul 23, 2017
  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    @mespedido yey,,, congrats!!!

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @mespedido congrats

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • joyousmasterjoyousmaster Posts: 90Member
    Joined: Oct 30, 2013
    congrats sis @mespedido :)

    May 2013 - submitted assessment in ACS
    Aug 2013 - got the result. Quite unfavorable due to lack of experience recognized
    Oct 2013 - took IELTS exam. Did not meet the desired score
    Nov 2013 - re-take IELTS exam. Still did not meet the desired score
    Apr 2014 - re-take IELTS exam in the Philippines. Still, failed. I gave up at this point.
    Sep 2015 - submitted another ACS assessment. Decided to pursue again since B and I separated. Para makamove on kuno haha!
    Sep 2015 - got the result with favorable reply. Still assessed under subclass 190 (state dependent) though.
    Apr 2016 - took PTE exam instead. Did not meet required score
    May 2016 - re-take PTE exam. FINALLY! got the desired score!
    May 2016 - Submitted EOI for South Australia
    Jul 2016 - Submitted EOI for New South Wales
    May 2017 - got the invitation to apply for state sponsorship! Thank you God! got approved on the same month
    Jul 2017 - Visa lodge
    Aug 2017 - First CO contact. Asking for B's credentials, Singapore police clearance, etc
    Aug 2017 - Medical
    Sep 2017 - Provided documents
    Nov 2017 - Second CO contact. Asking for more information
    Dec 2017 - Provided documents
    Mar 13, 2018 - Expired passport
    Mar 28, 2018 - Renewed passport
    April 11, submitted new passport
    April 23 - GRANT :) thank GOD!

    JULY 28, 2018 - IED

  • mespedidomespedido Singapore
    Posts: 302Member
    Joined: Aug 02, 2017
    Nangangatal pa ako hanggang ngayon!! Nagbukas ako ng email ng 9:27am, may email na pala ng 8:02am!!!! ☺️ Maraming Salamat sa inyong lahat, big help kayo sa aking journey to visa grant! Naging kasama ko kayo dito sa paghihintay!! @Heprex thank you sa pagbuo mo ng #teamfeedback feeling ko talaga nakatulong yun! Nagsend ako ng complaint yesterday! Hahaha! Maraming salamat sa inyong lahat!!! Sana magrant na lahat ng nandito sa forum!
  • pahpuhpahpuh Australia
    Posts: 106Member
    Joined: Oct 06, 2017
    @mespedido congrats! :)

    233411 - Electronics Engineer | Age: 30pts | Education: 15pts | Experience: 10pts | English: 20pts | Total: 75pts

    5-25-2017 - IELTS examination
    7-26-2017 - CDR assessment EA
    8-15-2017 - EA Assessment result
    9-28-2017 - PTE-A exam
    9-30-2017 - submit EOI 189
    10-4-2017 - Invitation
    11-9-2017 - VISA Lodge
    30-1-2018 - CO contact
    21-2-2018 - Send Feedback
    22-2-2018 - Visa Grant :)

  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    edited March 2018
    Try ko mag update, habang nag eenjoy si sir @siantiangco :)

    Name | Lodgement Date | Visa Type | CO Contact Date | CO Requested Info.

    1. @dutchmilk l Oct 12 l 489 l Nov 20
    2. @joyousmaster l Jul 23 l |1st CO: Aug 23 l 2nd CO: Nov 24
    3. @hi po l Oct 31 / 190 / Dec 18 / re upload NBI
    4. @Bonifacio | 20 Oct 2017 | 189 | 21 Dec 2017 | Wife Police Clearance
    5. @jjjj | 04 Jun 2017 | 190 | 22 Jan 2018 | Newborn Medicals
    6. @victorious | Nov 21 | 190 | Jan 29 | Main applicant Medical tests
    8. @UbePandesal | Dec 05 | 190 | Feb 14 | Form80 (Both) , NBI & SG Police Clearance (Husband)
    9. @vincechaos | Dec 05 | 190 | Feb 21 | employment reference (which I have already submitted)

    Grants :x :D

    Name | Lodgement Date | Visa Type | CO Contact Date | CO Requested Info.

    1. @dy3p | Sep 11 | 189 | Oct 17 | Further evidence of employment income in 2008, 2009 (unclaimed points experience) and repeat medical exam (done 5 months prior to lodging) - GRANT RECEIVED (FEB 16) :x
    2. @rvrecabar l Sep 10 l Oct 18 - GRANT RECEIVED (FEB 21) :x
    3. @CroweAltius | Sep 13 | 189 | Oct 23 | Additional Proof of De Facto Relationship - GRANT RECEIVED (FEB 22) :x
    4. @sherwinm | Sep 17 | 189 | Oct 23 | Form 80 and wife’s education certificate - GRANT RECEIVED (FEB 22) :x
    5. @WaterYogi | Sep 07 | 189 | Oct 25 | Form 80, BioData, Evidence of Name Change(though di ako nagbago ng name.) - GRANT RECEIVED (FEB 22) :x
    6. @jacjacjac | Aug 30 | Oct 25 | Japan Police Clearance, NBI, Daughter’s health clearance (given Dec 12 as per emedical client) - GRANT RECEIVED (FEB 3) :x
    7. @amoj | Sep 20 | 189 | Oct 31 | Further evidence of de facto partnership - GRANT RECEIVED (MAR 6) :x
    8. @Hunter_08 | Sep 20 | 489 | Nov 1 | Send PTE result to DIBP - GRANT RECEIVED (MAR 6) :x
    9. @dorbsdee l Sep 21 l 189 | Nov 1 l Form 815 - GRANT RECEIVED - (MAR 9) :x
    10. @EGMS_AU2017 | Sep 25 | 189 |Nov 6 | main applicant bank statement - GRANT RECEIVED (FEB 22) :x
    11. @eww14 l Sep 23 l | Nov 7 l Evidence of relationship with spouse - GRANT RECEIVED (MAR 5) :x
    12. @siantiangco | Sep 25 | 189 | Nov 10 | further inquiries about GF (non-migrating) - GRANT RECEIVED (MAR 13) :x
    13. @patpatpat | Sep 30 | 189 | Nov 17 | form 815 for wife - GRANT RECEIVED (MAR 7) :x
    14. @soddie | Oct 7 | | Nov 14 | Form 815 for daughter, ACS positive assessment for spouse - GRANT RECEIVED (FEB 28) :x
    15. @KimBokJoo | Jul 18 | 189 |1st CO: Aug 21 | 2nd CO: Nov 17 - GRANT RECEIVED (FEB 21) :x
    16. @PMPdreamer | Jul 12 | | 1st CO: Aug 3, Medicals, Police Clearance and PTE | 2nd CO: Nov 24 l Form 815 - GRANT RECEIVED (MAR 7) :x
    17. @Shakespeare23 | July 14 | 189 | 1st CO: Aug 22 : Medicals | 2nd CO: Nov 24: Form 815 - GRANT RECEIVED - (MAR 6) :x
    18. @rpaid | Aug 10 | 189 | 1st CO: Sep 11| Medicals | 2nd CO: Sep 29 | 3rd CO: Dec 16 - GRANT RECEIVED (FEB 26) :x
    19. @ramon_tubero | Oct 25 | 189 | Jan 09 | Bank statement, UAE PCC, Acad transcripts - GRANT RECEIVED (MAR 5) :x
    20. @Noodles12 l Apr 11 l |1st CO: May 2 l 2nd CO: Aug 10 l 3rd CO: Nov 1 l 4th CO: Jan 17 - GRANT RECEIVED (FEB 21) :x
    21. @bob.ten | Nov 7 | 189 | Jan 23 | Form 815 for daughter - GRANT RECEIVED (FEB 26) :x
    22. @mespedido | Oct 11 | 189 | Nov 27 | employment evidence - GRANT RECEIVED (MAR 14) :x

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • kaidenMVHkaidenMVH Sydney
    Posts: 916Member
    Joined: Feb 02, 2016
    congrats @mespedido & @marimari

    312111 Architectural Draftsperson 80pts 190 NSW
    04/Apr/2017 VETASSES
    11/Jul/2017 VETASSES+
    Waiting for States to open.......
    26/Sep/2017 NSW open for 312111
    29/Sep/2017 PTE exam
    01/Oct/2017 PTE Result L85, R83, S79, W80
    02/Oct/2017 EOI 190 NSW
    20/Oct/2017 Pre Invite 190 NSW
    30/Oct/2017 SS Application 190 NSW
    21/Dec/2017 SS Approved/ITA 190 NSW
    20/Jan/2018 health exam, me and eldest son
    22/Jan/2018 eldest son mantoux TB test
    (no stock at SATA AMK on 20/Jan!)

    23/Jan/2018 health clearance (me)
    25/Jan/2018 health clearance (5 yr old son)
    29/Jan/2018 Singapore Police Force COC (me)
    03/Feb/2018 health clearance (youngest son)
    06/Feb/2018 Singapore Police Force COC (wife)
    06/Feb/2018 health clearance (wife)
    08/Feb/2018 Visa lodge! So help me God :-)
    29/May/2018 CO contact (PH PCC)
    05/Sep/2018 Golden Email! Thank you Lord!

    Romans 12:12 Rejoice in hope, be patient in tribulation, be constant in prayer.

    James 5:7-8 Be patient, therefore, brothers, until the coming of the Lord. See how the farmer waits for the precious fruit of the earth, being patient about it, until it receives the early and the late rains. You also, be patient. Establish your hearts, for the coming of the Lord is at hand.

    Proverbs 3:5-6 Trust in the LORD with all your heart, and do not lean on your own understanding. In all your ways acknowledge him, and he will make straight your paths.

    Onward to the next chapter!

  • mespedidomespedido Singapore
    Posts: 302Member
    Joined: Aug 02, 2017
    Salamat ulit ng madami @Heprex ☺️ Blessing ka talaga sa aming lahat! Si peter din CO ko! I love Peter! Hehe!☺️☺️
  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    @mespedido heheh no worries. all the best sa next step. :)

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • siantiangcosiantiangco Batangas City
    Posts: 417Member
    Joined: Oct 24, 2017
    Congrats @marimari :D

    Wowwwwww! @mespedido congrats sa buong family nyo! Araw2 may naggrant. Bago mag april eh clear na natin ang list! =D>
  • joyousmasterjoyousmaster Posts: 90Member
    Joined: Oct 30, 2013
    I don't think so @siantiangco , mga mid APril pa siguro ako :D

    May 2013 - submitted assessment in ACS
    Aug 2013 - got the result. Quite unfavorable due to lack of experience recognized
    Oct 2013 - took IELTS exam. Did not meet the desired score
    Nov 2013 - re-take IELTS exam. Still did not meet the desired score
    Apr 2014 - re-take IELTS exam in the Philippines. Still, failed. I gave up at this point.
    Sep 2015 - submitted another ACS assessment. Decided to pursue again since B and I separated. Para makamove on kuno haha!
    Sep 2015 - got the result with favorable reply. Still assessed under subclass 190 (state dependent) though.
    Apr 2016 - took PTE exam instead. Did not meet required score
    May 2016 - re-take PTE exam. FINALLY! got the desired score!
    May 2016 - Submitted EOI for South Australia
    Jul 2016 - Submitted EOI for New South Wales
    May 2017 - got the invitation to apply for state sponsorship! Thank you God! got approved on the same month
    Jul 2017 - Visa lodge
    Aug 2017 - First CO contact. Asking for B's credentials, Singapore police clearance, etc
    Aug 2017 - Medical
    Sep 2017 - Provided documents
    Nov 2017 - Second CO contact. Asking for more information
    Dec 2017 - Provided documents
    Mar 13, 2018 - Expired passport
    Mar 28, 2018 - Renewed passport
    April 11, submitted new passport
    April 23 - GRANT :) thank GOD!

    JULY 28, 2018 - IED

  • siantiangcosiantiangco Batangas City
    Posts: 417Member
    Joined: Oct 24, 2017
    @Heprex Thanks sir! Ask ko lang, may fb page na ba tayo dito mga kapatid? Pde kasi get together pag nasa Aus na. Hehe

    @joyousmaster have you tried calling them? Medyo tricky nga un sa near-expiry na passport.
  • jazmyne18jazmyne18 Singapore
    Posts: 574Member
    Joined: Jul 04, 2017
    wow, nauubos na kayo!

    Congrats, @marimari & @mespedido !

    MAIN APPLICANT: Husband

    2016 07 16 - IELTS Exam
    2016 07 26 - IELTS Result: PROFICIENT <3
    2017 09 11 - EA Assessment [Fast Track]
    2017 09 29 - EA Assessment Outcome: COMPETENT <3
    2017 09 30 - EOI
    2017 10 04 - ITA <3
    2017 11 03 - Lodged Visa 189
    2018 01 15 - Counting ends here, after 73 days: VISA GRANT <3

  • joyousmasterjoyousmaster Posts: 90Member
    Joined: Oct 30, 2013
    Hindi pa @siantiangco but feeling ko hihintayin nga nila yun. Oh well. Ano ba nman ung 1 month. nakapaghintay nga ako ng 8 months hehe.. goodluck sa lahat :)

    May 2013 - submitted assessment in ACS
    Aug 2013 - got the result. Quite unfavorable due to lack of experience recognized
    Oct 2013 - took IELTS exam. Did not meet the desired score
    Nov 2013 - re-take IELTS exam. Still did not meet the desired score
    Apr 2014 - re-take IELTS exam in the Philippines. Still, failed. I gave up at this point.
    Sep 2015 - submitted another ACS assessment. Decided to pursue again since B and I separated. Para makamove on kuno haha!
    Sep 2015 - got the result with favorable reply. Still assessed under subclass 190 (state dependent) though.
    Apr 2016 - took PTE exam instead. Did not meet required score
    May 2016 - re-take PTE exam. FINALLY! got the desired score!
    May 2016 - Submitted EOI for South Australia
    Jul 2016 - Submitted EOI for New South Wales
    May 2017 - got the invitation to apply for state sponsorship! Thank you God! got approved on the same month
    Jul 2017 - Visa lodge
    Aug 2017 - First CO contact. Asking for B's credentials, Singapore police clearance, etc
    Aug 2017 - Medical
    Sep 2017 - Provided documents
    Nov 2017 - Second CO contact. Asking for more information
    Dec 2017 - Provided documents
    Mar 13, 2018 - Expired passport
    Mar 28, 2018 - Renewed passport
    April 11, submitted new passport
    April 23 - GRANT :) thank GOD!

    JULY 28, 2018 - IED

  • UbePandesalUbePandesal Singapore
    Posts: 169Member
    Joined: Feb 28, 2017
    @Heprex salamats sa pag update..

    @marimari & @mespedido Congratz!!

    pancin q halos 189 CO Contacts na Grant...sana kme den.. ;;) [-O< [-O< [-O<

    "Patience is not about waiting, But the Ability to keep a Good attitude while waiting"

    "Just Remember, Eventually the waiting will pay off"

  • sherwinmsherwinm singapore
    Posts: 108Member
    Joined: Apr 25, 2017
    @mespedido congrats!

    110317 - Visited Oz
    110517 - IELTS S Exam
    130517 - IELTS LRW Exam
    260517 - IELTS Result
    100617 - Submitted to EA w/ RSA
    280617 - EA positive outcome
    280617 - EOI submitted
    060917 - LOI
    140917 - Visa Lodge
    231017 - CO request addl docs
    220218 - Grant

  • l0kil0ki Posts: 45Member
    Joined: Oct 25, 2017
    @joyousmaster hi po! May kilala po ako na same situation as you. Expired din passport nya and yan ang reason na na CO contact xa
  • joyousmasterjoyousmaster Posts: 90Member
    Joined: Oct 30, 2013
    @l0ki thanks for the confirmation. So wala talaga ako choice. haha. magcomplain kaya ako na kung hindi nila pinaabot ng March yun eh di sana wala akong problema.. hehe joke. :D

    May 2013 - submitted assessment in ACS
    Aug 2013 - got the result. Quite unfavorable due to lack of experience recognized
    Oct 2013 - took IELTS exam. Did not meet the desired score
    Nov 2013 - re-take IELTS exam. Still did not meet the desired score
    Apr 2014 - re-take IELTS exam in the Philippines. Still, failed. I gave up at this point.
    Sep 2015 - submitted another ACS assessment. Decided to pursue again since B and I separated. Para makamove on kuno haha!
    Sep 2015 - got the result with favorable reply. Still assessed under subclass 190 (state dependent) though.
    Apr 2016 - took PTE exam instead. Did not meet required score
    May 2016 - re-take PTE exam. FINALLY! got the desired score!
    May 2016 - Submitted EOI for South Australia
    Jul 2016 - Submitted EOI for New South Wales
    May 2017 - got the invitation to apply for state sponsorship! Thank you God! got approved on the same month
    Jul 2017 - Visa lodge
    Aug 2017 - First CO contact. Asking for B's credentials, Singapore police clearance, etc
    Aug 2017 - Medical
    Sep 2017 - Provided documents
    Nov 2017 - Second CO contact. Asking for more information
    Dec 2017 - Provided documents
    Mar 13, 2018 - Expired passport
    Mar 28, 2018 - Renewed passport
    April 11, submitted new passport
    April 23 - GRANT :) thank GOD!

    JULY 28, 2018 - IED

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

geecosemijormonErikaMatavirgobabyElmerson14redculturevulturearkigraceorbitakingisfromphhael17moonytrxmaikzxperezjecillevmalicdempayterwynpayterwyn_007kimpz0701HowardElerbjayallenb_sydneykbadmd
Browse Members

Members Online (0) + Guest (153)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌