Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

Case Officer (CO) Contact Thread

14748505253129

Comments

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    oo nga ang tahimik ngayon.. nagaantay pa din ako dito para sa mga susunod na mabibigyan ng grant.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • UbePandesalUbePandesal Singapore
    Posts: 169Member
    Joined: Feb 28, 2017
    :-\" :-\" :-\"

    Good Morning...

    "Patience is not about waiting, But the Ability to keep a Good attitude while waiting"

    "Just Remember, Eventually the waiting will pay off"

  • dutchmilkdutchmilk Newcastle NSW
    Posts: 258Member
    Joined: Feb 06, 2016
    Magtatanong lng po sa mga na CO contact on form 815.

    Ano pa bah case nyo? May nakitang abnormality sa chest xray? At pina sputum test bah kayo and repeat xray after 3 months?
  • rj09rj09 Australia
    Posts: 112Member
    Joined: Aug 10, 2016
    @dutchmilk false positive sa TST tapos pinaxray para i-confirm. Negative naman talaga at "Health Clearance Provided. No action required" na ang status ng medical sa immiaccount. Ewan ko bat hiningan pa din.

    261313 -Software Engineer | Age: 30pts | Education: 15 | Experience: 15 | English: 10 | Total: 70

    Aug 2016 - Joined Pinoy AU Forum
    Jul 17, 2017 - Start preparing docs for ACS
    Aug 14, 2017 - Submitted application for ACS assessment
    Sep 11, 2017 - PTE exam. L: 90 - S: 80 - R: 78 - W: 82 (Sayang! Superior na sana)
    Sep 20, 2017 - Received my ACS Assessment
    Sep 26, 2017 - PTE Retake L: 83 - S: 77 - R: 87 - W: 88 (sayang na naman hindi umabot!)
    Oct 21, 2017 - EOI Lodged (189 - 70 pts)
    Nov 8, 2017 - Received ITA for 189
    Nov 13, 2017 - Lodged Visa 189
    Nov 20, 2017 - NBI Fingerprinting and SG COC Fingerprinting appointment (Received SG COC on the same day)
    Dec 2, 2017 - Medical @ SATA AMK (Me & my Daughter)
    Dec 5, 2017 - Medical @ SATA AMK (Husband) and TST Reading for our daughter
    Dec 7, 2017 - Medical cleared (Husband & Daughter). No action required.
    Dec 11, 2017 - Medical cleared (primary applicant). No action required.
    Feb 1, 2018 - CO Contact. Requested Form 815 Health Undertaking for my daughter. Submitted the form on the same day.
    March 8, 2018 - Got our grant!! Thank you Lord!
    July 2, 2018 - Husband's Big Move (Melbourne)
    Sept 14, 2018 - Me and my daughter's Big Move

  • dutchmilkdutchmilk Newcastle NSW
    Posts: 258Member
    Joined: Feb 06, 2016
    @rj09 ic. sa anak nyo dba? nagtatanong tanong lang kc ako repeat xray lng, di na nag sputum test. sana may same case sakin at di na hiningan pa ng form 815. di kc kami maka frontload nun kc under agency kami.
  • Noodles12Noodles12 Sydney
    Posts: 495Member
    Joined: May 12, 2016
    dutchmilk said:

    @rj09 ic. sa anak nyo dba? nagtatanong tanong lang kc ako repeat xray lng, di na nag sputum test. sana may same case sakin at di na hiningan pa ng form 815. di kc kami maka frontload nun kc under agency kami.

    Na CO contact ka na ba? or nag aalala ka baka hingan ka?

    261312 - Developer Programmer
    May 2016 - Started gathering ACS requirements
    May 2016 - IELTS self review
    Jun 2016 - PTE-A self review (Haven't decided which one will choose between IELTS and PTE)
    Jun 16 2016 - Completed employment references for ACS assessment.
    Jun 28 2016 - Submitted requirements to ACS
    Jul 08 2016 - Received ACS Result. (AQF Bachelor Degree with a major in computing, 7yrs ++ years credited. sayang nde pa naging 8yrs)
    Sep 08 2016 - IELTS Speaking Test
    Sep 10 2016 - IELTS Listening, Reading and Writing Test
    Sep 23 2016 - IELTS Result (L7.5, R7, S8, W6.5) :(
    Sep 26 2016 - Applied for remarking
    Nov 30 2016 - Got result for remarking, score did not changed (wasted precious time)
    Dec 20 2016 - Took PTE-A Exam
    Dec 21 2016 - Got PTE Result (L 77, R, 70, S 82, W 80) Thank God!
    Dec 27 2016 - Submitted EOI 189 (65pts)
    Feb 2, 2017 - EOI pts updated to 70 pts due to 8yrs work experience milestone.
    Feb 15, 2017 - Invited to lodge
    March 25, 2017 - Medical at Nationwide Makati
    Apr 11, 2017 - Lodge Application
    Apr 12, 2017 - Front loaded Docs
    May 2, 2017 - CO Contact GSM Adelaide - Requesting for additional Employment evidence, Health Dec for child, Additional De facto Evidence, Consent for Child.
    May 15, 2017 - Submitted all docs requested by CO.
    Aug 10, 2017 - Second CO contact requesting for partner's evidence of functional English (even though we submitted this during lodging)
    Aug 11, 2017 - Submitted CO requested document.
    Nov 1, 2017 3rd CO Contact requesting for new medical exam for daughter since the TB test already expired.

    (panong nde ma eexpire eh ang tagal tagal na namin nag lodge. Malapit nadin mag expire yung NBI clearance ko so sa 4th CO contact rerequest naman ng new NBI clearance?)

    Nov 11, 2017 - Medical of daughter
    Jan 12, 2017 - Submitted New NBI Clearance
    Jan 17, 2018 - 4th CO Contact requesting for Health undertaking form for our daughter. Submit the form the same day.
    Feb 20, 2018 - Sent Feedback to DIBP regarding how slow the processing of the CO.
    Feb 21, 2018 - Grant Received!!!
    May 11, 2018 - Initial Entry at Sydney
    Dec 2018 or Jan 2019 Tentative big move!

  • dutchmilkdutchmilk Newcastle NSW
    Posts: 258Member
    Joined: Feb 06, 2016
    @Noodles12 baka hingan po. under agency kc kami at hindi ma frontload yung form, though naka mirror ako sa application namin. baka kc magalit agent namin if mag upload kami ng docs without her knowledge.
  • UbePandesalUbePandesal Singapore
    Posts: 169Member
    Joined: Feb 28, 2017
    @dutchmilk mas maganda cgro kung ma upload nio agad... since may time p kau pra ma upload lahat ng documents...
    much better na Inform si Agent also na mag upload kau or pilitin nio ung Agent na iupload ung Form 815

    "Patience is not about waiting, But the Ability to keep a Good attitude while waiting"

    "Just Remember, Eventually the waiting will pay off"

  • OZingwithOZomenessOZingwithOZomeness Kung Saan ang Lahat gusto pumunta sa forum na ito, so alam niyo na yun.
    Posts: 543Member
    Joined: Oct 20, 2017
    @dutchmilk dapat ikaw nagagalit sa agent kasi ikaw nagbabayad sa kanila. ikaw ang ngpapasahod kumbaga hahaha. kaya wag ka matakot kasi dapat ikaw ang amo nila hehe
  • Noodles12Noodles12 Sydney
    Posts: 495Member
    Joined: May 12, 2016
    @dutchmilk yes, agree sa kanila even though naka agent ka dapat ikaw padin ang masusunod. I suggest iforce mo sila na iupload yung form. If ayaw at na CO contact ka for that form then request ka ng partial refund. hehe

    261312 - Developer Programmer
    May 2016 - Started gathering ACS requirements
    May 2016 - IELTS self review
    Jun 2016 - PTE-A self review (Haven't decided which one will choose between IELTS and PTE)
    Jun 16 2016 - Completed employment references for ACS assessment.
    Jun 28 2016 - Submitted requirements to ACS
    Jul 08 2016 - Received ACS Result. (AQF Bachelor Degree with a major in computing, 7yrs ++ years credited. sayang nde pa naging 8yrs)
    Sep 08 2016 - IELTS Speaking Test
    Sep 10 2016 - IELTS Listening, Reading and Writing Test
    Sep 23 2016 - IELTS Result (L7.5, R7, S8, W6.5) :(
    Sep 26 2016 - Applied for remarking
    Nov 30 2016 - Got result for remarking, score did not changed (wasted precious time)
    Dec 20 2016 - Took PTE-A Exam
    Dec 21 2016 - Got PTE Result (L 77, R, 70, S 82, W 80) Thank God!
    Dec 27 2016 - Submitted EOI 189 (65pts)
    Feb 2, 2017 - EOI pts updated to 70 pts due to 8yrs work experience milestone.
    Feb 15, 2017 - Invited to lodge
    March 25, 2017 - Medical at Nationwide Makati
    Apr 11, 2017 - Lodge Application
    Apr 12, 2017 - Front loaded Docs
    May 2, 2017 - CO Contact GSM Adelaide - Requesting for additional Employment evidence, Health Dec for child, Additional De facto Evidence, Consent for Child.
    May 15, 2017 - Submitted all docs requested by CO.
    Aug 10, 2017 - Second CO contact requesting for partner's evidence of functional English (even though we submitted this during lodging)
    Aug 11, 2017 - Submitted CO requested document.
    Nov 1, 2017 3rd CO Contact requesting for new medical exam for daughter since the TB test already expired.

    (panong nde ma eexpire eh ang tagal tagal na namin nag lodge. Malapit nadin mag expire yung NBI clearance ko so sa 4th CO contact rerequest naman ng new NBI clearance?)

    Nov 11, 2017 - Medical of daughter
    Jan 12, 2017 - Submitted New NBI Clearance
    Jan 17, 2018 - 4th CO Contact requesting for Health undertaking form for our daughter. Submit the form the same day.
    Feb 20, 2018 - Sent Feedback to DIBP regarding how slow the processing of the CO.
    Feb 21, 2018 - Grant Received!!!
    May 11, 2018 - Initial Entry at Sydney
    Dec 2018 or Jan 2019 Tentative big move!

  • dutchmilkdutchmilk Newcastle NSW
    Posts: 258Member
    Joined: Feb 06, 2016
    @UbePandesal @OZingwithOZomeness hahaha! Actually hindi lng form 815 ang inaalala ko. Pati form 80. Hindi rin kc na upload yun eh kc sabi ni agent hindi na raw required dahil hindi hiningi nung na CO contact kami last Nov. At assessent in progress na daw ang status ng application namin.

    Dasal nalang cguro sandata namin na hindi na kami ma CO contact pa. Sana malakas ako kay Lord.
  • dutchmilkdutchmilk Newcastle NSW
    Posts: 258Member
    Joined: Feb 06, 2016
    @Noodles12 hahaha! Sabay sabi, "ayooo! now how? told you leh!"
  • UbePandesalUbePandesal Singapore
    Posts: 169Member
    Joined: Feb 28, 2017
    @dutchmilk ahh..na CO kau last November.. anu hiningi documents? hehe... d nka indicate sa List...

    "Patience is not about waiting, But the Ability to keep a Good attitude while waiting"

    "Just Remember, Eventually the waiting will pay off"

  • marimarimarimari Australia
    Posts: 107Member
    Joined: Feb 18, 2017
    @dutchmilk hello, upload mo na.. kahit naman na assessment in progress ka pwede ka pa attach ng documents :) ung CO hiningan ako ng document kahit na hindi naman ito nakalagay sa list reqts nung 1st CO contact ko.. its better na one step ahead ka sa CO.. :)
  • dutchmilkdutchmilk Newcastle NSW
    Posts: 258Member
    Joined: Feb 06, 2016
    @UbePandesal uu na CO na kami last Nov. NBI at SG COC for me and my husband then Proof of English sakin.


    @marimari Ano po yung mga hiningu nung 1st and 2nd CO mo? Hmmmm. Pano kaya to? In what way namin sasabihin kay agent na parang hindi din namin cla pinangunguhanan?
  • dutchmilkdutchmilk Newcastle NSW
    Posts: 258Member
    Joined: Feb 06, 2016
    edited March 2018
    Kailangan bah talaga hand written yung form 815 and I need to sign on it, right?
  • ramon_tuberoramon_tubero Dubai
    Posts: 54Member
    Joined: Oct 09, 2017
    sir @Noodles12 nakalagay ba yung form 815 sa grant letter niyo? ako kasi nagkaissue din sa xray ko and nag sputum culture at repeat xray ako and inuna ko ng binigay yung 815 kahit hindi hiningi. ngayon hindi ako sure if may form 815 condition sa grant ko...

    233311 - Electrical Engineer | Age: 25pts | Education: 15pts | Experience: 15pts | English: 20pts | Total: 75pts

    02-Sep-17 IELTS (GT) LRSW-8/7.5/6.5/6 (T_T)
    05-Sep-17 Submitted Engineers Australia (EA) assessment for 233311 PE Electrical Engr.
    28-Sep-17 EA assessment outcome (positive - 233311)
    08-Oct-17 PTE exam (take 1) (LRSW-88/81/90/79) Thank you Lord!
    09-Oct-17 Updated EOI (189-75 points)
    18-Oct-17 Received invitation (189)
    18-Oct-17 Medical started
    25-Oct-17 Lodged visa application
    09-Jan-18 CO Contact for (a.) transcript (b.) bank statement (c.) UAE PCC
    25-Jan-18 IP pressed
    05-Mar-18 Grant - IED 13/Oct/18 (Thank you po Lord!)
    31-May-18 Big move
    18-Jun-18 Got hired :)
    02-Jul-18 First day of work

  • PMPdreamerPMPdreamer Mandaluyong
    Posts: 293Member
    Joined: Apr 13, 2017
    God is good! I got my grant at exactly 13:00 today! visa 190 family of 3! grabeee di ako maka focus nasa meeting pa naman akooooo!!!!
  • CroweAltiusCroweAltius Mandaluyong
    Posts: 72Member
    Joined: Sep 13, 2017
    Congratz @PMPdreamer!!
  • dutchmilkdutchmilk Newcastle NSW
    Posts: 258Member
    Joined: Feb 06, 2016
    @PMPdreamer congrats po!
  • pahpuhpahpuh Australia
    Posts: 106Member
    Joined: Oct 06, 2017
    @PMPdreamer congrats! :)

    233411 - Electronics Engineer | Age: 30pts | Education: 15pts | Experience: 10pts | English: 20pts | Total: 75pts

    5-25-2017 - IELTS examination
    7-26-2017 - CDR assessment EA
    8-15-2017 - EA Assessment result
    9-28-2017 - PTE-A exam
    9-30-2017 - submit EOI 189
    10-4-2017 - Invitation
    11-9-2017 - VISA Lodge
    30-1-2018 - CO contact
    21-2-2018 - Send Feedback
    22-2-2018 - Visa Grant :)

  • kaidenMVHkaidenMVH Sydney
    Posts: 916Member
    Joined: Feb 02, 2016
    @PMPdreamer congrats!

    312111 Architectural Draftsperson 80pts 190 NSW
    04/Apr/2017 VETASSES
    11/Jul/2017 VETASSES+
    Waiting for States to open.......
    26/Sep/2017 NSW open for 312111
    29/Sep/2017 PTE exam
    01/Oct/2017 PTE Result L85, R83, S79, W80
    02/Oct/2017 EOI 190 NSW
    20/Oct/2017 Pre Invite 190 NSW
    30/Oct/2017 SS Application 190 NSW
    21/Dec/2017 SS Approved/ITA 190 NSW
    20/Jan/2018 health exam, me and eldest son
    22/Jan/2018 eldest son mantoux TB test
    (no stock at SATA AMK on 20/Jan!)

    23/Jan/2018 health clearance (me)
    25/Jan/2018 health clearance (5 yr old son)
    29/Jan/2018 Singapore Police Force COC (me)
    03/Feb/2018 health clearance (youngest son)
    06/Feb/2018 Singapore Police Force COC (wife)
    06/Feb/2018 health clearance (wife)
    08/Feb/2018 Visa lodge! So help me God :-)
    29/May/2018 CO contact (PH PCC)
    05/Sep/2018 Golden Email! Thank you Lord!

    Romans 12:12 Rejoice in hope, be patient in tribulation, be constant in prayer.

    James 5:7-8 Be patient, therefore, brothers, until the coming of the Lord. See how the farmer waits for the precious fruit of the earth, being patient about it, until it receives the early and the late rains. You also, be patient. Establish your hearts, for the coming of the Lord is at hand.

    Proverbs 3:5-6 Trust in the LORD with all your heart, and do not lean on your own understanding. In all your ways acknowledge him, and he will make straight your paths.

    Onward to the next chapter!

  • Noodles12Noodles12 Sydney
    Posts: 495Member
    Joined: May 12, 2016

    sir @Noodles12 nakalagay ba yung form 815 sa grant letter niyo? ako kasi nagkaissue din sa xray ko and nag sputum culture at repeat xray ako and inuna ko ng binigay yung 815 kahit hindi hiningi. ngayon hindi ako sure if may form 815 condition sa grant ko...

    Wala naman nakalagay na anything related sa form 815 sa grant letter.

    261312 - Developer Programmer
    May 2016 - Started gathering ACS requirements
    May 2016 - IELTS self review
    Jun 2016 - PTE-A self review (Haven't decided which one will choose between IELTS and PTE)
    Jun 16 2016 - Completed employment references for ACS assessment.
    Jun 28 2016 - Submitted requirements to ACS
    Jul 08 2016 - Received ACS Result. (AQF Bachelor Degree with a major in computing, 7yrs ++ years credited. sayang nde pa naging 8yrs)
    Sep 08 2016 - IELTS Speaking Test
    Sep 10 2016 - IELTS Listening, Reading and Writing Test
    Sep 23 2016 - IELTS Result (L7.5, R7, S8, W6.5) :(
    Sep 26 2016 - Applied for remarking
    Nov 30 2016 - Got result for remarking, score did not changed (wasted precious time)
    Dec 20 2016 - Took PTE-A Exam
    Dec 21 2016 - Got PTE Result (L 77, R, 70, S 82, W 80) Thank God!
    Dec 27 2016 - Submitted EOI 189 (65pts)
    Feb 2, 2017 - EOI pts updated to 70 pts due to 8yrs work experience milestone.
    Feb 15, 2017 - Invited to lodge
    March 25, 2017 - Medical at Nationwide Makati
    Apr 11, 2017 - Lodge Application
    Apr 12, 2017 - Front loaded Docs
    May 2, 2017 - CO Contact GSM Adelaide - Requesting for additional Employment evidence, Health Dec for child, Additional De facto Evidence, Consent for Child.
    May 15, 2017 - Submitted all docs requested by CO.
    Aug 10, 2017 - Second CO contact requesting for partner's evidence of functional English (even though we submitted this during lodging)
    Aug 11, 2017 - Submitted CO requested document.
    Nov 1, 2017 3rd CO Contact requesting for new medical exam for daughter since the TB test already expired.

    (panong nde ma eexpire eh ang tagal tagal na namin nag lodge. Malapit nadin mag expire yung NBI clearance ko so sa 4th CO contact rerequest naman ng new NBI clearance?)

    Nov 11, 2017 - Medical of daughter
    Jan 12, 2017 - Submitted New NBI Clearance
    Jan 17, 2018 - 4th CO Contact requesting for Health undertaking form for our daughter. Submit the form the same day.
    Feb 20, 2018 - Sent Feedback to DIBP regarding how slow the processing of the CO.
    Feb 21, 2018 - Grant Received!!!
    May 11, 2018 - Initial Entry at Sydney
    Dec 2018 or Jan 2019 Tentative big move!

  • PMPdreamerPMPdreamer Mandaluyong
    Posts: 293Member
    Joined: Apr 13, 2017
    thanks @CroweAltius @dutchmilk @pahpuh @kaidenMVH ! i will finally have a peaceful weekend
  • Noodles12Noodles12 Sydney
    Posts: 495Member
    Joined: May 12, 2016
    @PMPdreamer Congrats!

    261312 - Developer Programmer
    May 2016 - Started gathering ACS requirements
    May 2016 - IELTS self review
    Jun 2016 - PTE-A self review (Haven't decided which one will choose between IELTS and PTE)
    Jun 16 2016 - Completed employment references for ACS assessment.
    Jun 28 2016 - Submitted requirements to ACS
    Jul 08 2016 - Received ACS Result. (AQF Bachelor Degree with a major in computing, 7yrs ++ years credited. sayang nde pa naging 8yrs)
    Sep 08 2016 - IELTS Speaking Test
    Sep 10 2016 - IELTS Listening, Reading and Writing Test
    Sep 23 2016 - IELTS Result (L7.5, R7, S8, W6.5) :(
    Sep 26 2016 - Applied for remarking
    Nov 30 2016 - Got result for remarking, score did not changed (wasted precious time)
    Dec 20 2016 - Took PTE-A Exam
    Dec 21 2016 - Got PTE Result (L 77, R, 70, S 82, W 80) Thank God!
    Dec 27 2016 - Submitted EOI 189 (65pts)
    Feb 2, 2017 - EOI pts updated to 70 pts due to 8yrs work experience milestone.
    Feb 15, 2017 - Invited to lodge
    March 25, 2017 - Medical at Nationwide Makati
    Apr 11, 2017 - Lodge Application
    Apr 12, 2017 - Front loaded Docs
    May 2, 2017 - CO Contact GSM Adelaide - Requesting for additional Employment evidence, Health Dec for child, Additional De facto Evidence, Consent for Child.
    May 15, 2017 - Submitted all docs requested by CO.
    Aug 10, 2017 - Second CO contact requesting for partner's evidence of functional English (even though we submitted this during lodging)
    Aug 11, 2017 - Submitted CO requested document.
    Nov 1, 2017 3rd CO Contact requesting for new medical exam for daughter since the TB test already expired.

    (panong nde ma eexpire eh ang tagal tagal na namin nag lodge. Malapit nadin mag expire yung NBI clearance ko so sa 4th CO contact rerequest naman ng new NBI clearance?)

    Nov 11, 2017 - Medical of daughter
    Jan 12, 2017 - Submitted New NBI Clearance
    Jan 17, 2018 - 4th CO Contact requesting for Health undertaking form for our daughter. Submit the form the same day.
    Feb 20, 2018 - Sent Feedback to DIBP regarding how slow the processing of the CO.
    Feb 21, 2018 - Grant Received!!!
    May 11, 2018 - Initial Entry at Sydney
    Dec 2018 or Jan 2019 Tentative big move!

  • bob.tenbob.ten Manila
    Posts: 31Member
    Joined: Jan 23, 2018
  • PMPdreamerPMPdreamer Mandaluyong
    Posts: 293Member
    Joined: Apr 13, 2017
  • PMPdreamerPMPdreamer Mandaluyong
    Posts: 293Member
    Joined: Apr 13, 2017
    @bob.ten thanks po
  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    Congrats @PMPdreamer. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    congrats @PMPdreamer

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

mich29geecosemijormonErikaMatavirgobabyElmerson14redculturevulturearkigraceorbitakingisfromphhael17moonytrxmaikzxperezjecillevmalicdempayterwynpayterwyn_007kimpz0701HowardElerbjayallenb_sydney
Browse Members

Members Online (0) + Guest (152)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌