Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

Case Officer (CO) Contact Thread

14243454748129

Comments

  • amojamoj Taguig
    Posts: 157Member
    Joined: Apr 24, 2017
    @EGMS_AU2017 so alis kayo kagad?

    263311 Telecommunications Engineer

    Points Total: 75 Points
    Age: 32 - 30 points
    English: Superior - 20 points
    Employment Experience: 5-7 Years - 10 points
    Education: BS Degree: 15 points

    Timeline:
    03/05/2017 - IELTS General Exam (L7.5/R9/W7/S6.5) - 10 Points
    04/11/2017 - Submitted EA Assessment (Fast track)
    05/11/2017 - EA Contact Requesting Change of CDRs
    05/18/2017 - Sent New CDRs
    05/29/2017 - EA Positive Outcome Granted
    05/29/2017 - Submitted EOI (Visa 189) w/ 65 Points
    08/14/2017 - PTE Academic Exam (L82/R90/W90/S90) - increased to 20 Points
    08/16/2017 - Resubmitted EOI (Visa 189) w/ 75 Points
    08/23/2017 - ITA Received!!!
    09/16/2017 - Medicals taken at Nationwide Makati
    09/20/2017 - Visa 189 Lodged
    10/31/2017 - CO Contact requesting for additional supporting documents for de facto partner
    11/03/2017 - Provided needed documents
    03/06/2018 - Grant Received!!!
    04/12/2018 - Big Move to Sydney

  • amojamoj Taguig
    Posts: 157Member
    Joined: Apr 24, 2017
    @EGMS_AU2017 ay sorry mali pagkakaintindi ko.. hehe

    263311 Telecommunications Engineer

    Points Total: 75 Points
    Age: 32 - 30 points
    English: Superior - 20 points
    Employment Experience: 5-7 Years - 10 points
    Education: BS Degree: 15 points

    Timeline:
    03/05/2017 - IELTS General Exam (L7.5/R9/W7/S6.5) - 10 Points
    04/11/2017 - Submitted EA Assessment (Fast track)
    05/11/2017 - EA Contact Requesting Change of CDRs
    05/18/2017 - Sent New CDRs
    05/29/2017 - EA Positive Outcome Granted
    05/29/2017 - Submitted EOI (Visa 189) w/ 65 Points
    08/14/2017 - PTE Academic Exam (L82/R90/W90/S90) - increased to 20 Points
    08/16/2017 - Resubmitted EOI (Visa 189) w/ 75 Points
    08/23/2017 - ITA Received!!!
    09/16/2017 - Medicals taken at Nationwide Makati
    09/20/2017 - Visa 189 Lodged
    10/31/2017 - CO Contact requesting for additional supporting documents for de facto partner
    11/03/2017 - Provided needed documents
    03/06/2018 - Grant Received!!!
    04/12/2018 - Big Move to Sydney

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    Gandang umaga guys.. I got the golden email na at sobrang ganda ng bungad ng email ko..hehehhe... Thank you Lord at thank you din sa lahat ng mga tumulong at mga kadamay dito.. hindi ako magsasawang tumulong pa sa iba..

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • rj09rj09 Australia
    Posts: 112Member
    Joined: Aug 10, 2016
    congrats @Hunter_08 finally!!!

    261313 -Software Engineer | Age: 30pts | Education: 15 | Experience: 15 | English: 10 | Total: 70

    Aug 2016 - Joined Pinoy AU Forum
    Jul 17, 2017 - Start preparing docs for ACS
    Aug 14, 2017 - Submitted application for ACS assessment
    Sep 11, 2017 - PTE exam. L: 90 - S: 80 - R: 78 - W: 82 (Sayang! Superior na sana)
    Sep 20, 2017 - Received my ACS Assessment
    Sep 26, 2017 - PTE Retake L: 83 - S: 77 - R: 87 - W: 88 (sayang na naman hindi umabot!)
    Oct 21, 2017 - EOI Lodged (189 - 70 pts)
    Nov 8, 2017 - Received ITA for 189
    Nov 13, 2017 - Lodged Visa 189
    Nov 20, 2017 - NBI Fingerprinting and SG COC Fingerprinting appointment (Received SG COC on the same day)
    Dec 2, 2017 - Medical @ SATA AMK (Me & my Daughter)
    Dec 5, 2017 - Medical @ SATA AMK (Husband) and TST Reading for our daughter
    Dec 7, 2017 - Medical cleared (Husband & Daughter). No action required.
    Dec 11, 2017 - Medical cleared (primary applicant). No action required.
    Feb 1, 2018 - CO Contact. Requested Form 815 Health Undertaking for my daughter. Submitted the form on the same day.
    March 8, 2018 - Got our grant!! Thank you Lord!
    July 2, 2018 - Husband's Big Move (Melbourne)
    Sept 14, 2018 - Me and my daughter's Big Move

  • EGMS_AU2017EGMS_AU2017 Singapore
    Posts: 439Member
    Joined: Sep 19, 2017
    @amoj hindi pa po sir. Oct pa po ang IED namin.
    So kung sa case nyo po pag d kau kumuha ng bagong nbi pag nagrant kau today meron nlng kau 1 month para mag IED kc nagbbase sila sa validity ng medical or PCC
  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    edited March 2018
    @Hunter_08 finally!!! congrats!! YEY!!! tuwang tuwa kame para sa iyo sir! all the best!!!

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • clj2012clj2012 Posts: 141Member
    Joined: Aug 10, 2017
    @Hunter_08 congrats!

    ANZSCO Code: 221214 – Internal Auditor
    (Age:25 / Education:15 / Experience:15 / English Test:20 = 75pts)
    02 Mar 2017 - Submitted documents for skill assessment
    02 May 2017 - Received result of assessment : Positive
    13 May 2017 - Took IELTS result withheld / results received Jul 10
    10 Jul 2017 - IELTS General Exam Result: L8.5/R9.0/S7.5/W7.0
    26 Jul 2017 - Lodged EOI : PR189 - 65pts
    08 Aug 2017 - PTE A Exam : L90/R90/S86/W89
    10 Aug 2017 - Updated EOI : PR189 - 75pts
    06 Dec 2017 - ITA - PR189
    21 Dec 2017 - Lodged Visa 189 - Frontloaded docs
    28 Dec 2017 - Medical exam completed (myself / husband / daughter)
    24 May 2018 - Direct Grant yey! :) - IED: 02 August 2018
    23 Jun 2018 - IED (1 week)
    13 Dec 2018 - BM! :)

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @rj09 thanks.

    @Heprex salamt bro.. at salamat sa mga tulong mo..hehehe.. iba pala tlga pakiramdam.

    btw yung nag approved sa akin si Lisa pero nag reply sa feedback ko si #Peter at sinabi na approved na daw yung application ko... :D

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @clj2012 thanks.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • dutchmilkdutchmilk Newcastle NSW
    Posts: 258Member
    Joined: Feb 06, 2016
    @Hunter_08 congrats sir! well deserve! kasalan na yan! :D
  • caienricaienri Sydney
    Posts: 212Member
    Joined: Jul 17, 2016
    @Hunter_08 parang kahapon lang sabi mo napag iwanan ka na... yan na oh!!! :)
    Congrats Sir!
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @dutchmilk thanks..hehehhe.. settle muna sa Au bago kasal..hahahah

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @caienri thanks..oo nga e sobrang thankful sa blessings..

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • cutsiechick21cutsiechick21 Adelaide
    Posts: 142Member
    Joined: Nov 09, 2016
    Congrats @Hunter_08 happy for you.. well deserved dahil ilaw din ang madalas magreply sakin :)

    511112 Program or Project Administrator

    02/08/2017 - IELTS Exam: L 8.5/R8/S7/W6.5
    09/08/2017 - Submitted docs to Vetassess
    10/19/2017 - Positive assessment (4 yrs) - 5pts
    10/23/2017 - PTE Exam
    10/23/2017 - Received PTE Result: L78/R90/S86/W86
    10/27/2017 - SS EOI / SA application submitted
    11/08/2017 - SS SA ITA received
    11/28/2017 - Police COC collection
    12/09/2017 - Visa lodged
    12/23/2017 - Medical @ Point Medical SG
    12/28/2017 - Repeat urine test due to high sugar
    02/20/2018 - Immi Assessment Commence Email
    03/27/2018 - CO asked for letter of consent for employment verification
    05/23/2018 - VISA GRANT
    07/2018 - Big Move

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @cutsiechick21 thank you..

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @Hunter_08 congrats! Finally grant na. God bless you sa BM. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    @Hunter_08 mukang hindi hawak ni Peter yung ibang subclass, pero at least, naiinform nya ata yung dapat mag handle. Kudos to Peter, at Maraming congrats sayo sir!

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • pahpuhpahpuh Australia
    Posts: 106Member
    Joined: Oct 06, 2017
    @Hunter_08 congrats :)

    233411 - Electronics Engineer | Age: 30pts | Education: 15pts | Experience: 10pts | English: 20pts | Total: 75pts

    5-25-2017 - IELTS examination
    7-26-2017 - CDR assessment EA
    8-15-2017 - EA Assessment result
    9-28-2017 - PTE-A exam
    9-30-2017 - submit EOI 189
    10-4-2017 - Invitation
    11-9-2017 - VISA Lodge
    30-1-2018 - CO contact
    21-2-2018 - Send Feedback
    22-2-2018 - Visa Grant :)

  • vincechaosvincechaos Sydney
    Posts: 335Member
    Joined: Nov 20, 2016
    @Hunter_08 Congrats! BM na! :D

    ANZSCO 221213 External Auditor
    [VISA 190-80 pts]
    (Age:30| PTE:20| Exp: 10| Educ:15| SS:5)

    26 November 2016 - Engaged MARA accredited agent
    11 February 2017 - PTE Mock Test A: L-77 R-72 S-60 W-82
    12 February 2017 - PTE Mock Test B: L-79 R-69 S-66 W-81
    14 February 2017 - PTE-A Exam
    18 February 2017 - PTE-A Exam: L-90 R-83 S-90 W-80 (Superior)
    19 February 2017 - VETASESS Migration Assessment (Internal Auditor)
    11 April 2017 - Full skills assessment - negative outcome
    17 August 2017 - Re-assessment - outcome review (employment) - negative outcome
    15 September 2017 - CPAA Migration Assessment (External Auditor)
    09 October 2017 - Result of assessment - academically suitable for migration under External Auditor. However, duties listed in the employment are considered to be closely related to "internal auditing".
    20 October 2017 - Appeal for External Auditor (Employment)
    03 November 2017 - Positive CPAA assessment! Yehey!
    03 November 2017 - Lodged EOI (189/190-NSW)
    17 November 2017 - Received invitation to apply for NSW state nomination.
    18 November 2017 - Lodged my nomination application with NSW.
    28 November 2017 - Approved application for NSW nomination and received an ITA for Visa 190
    05 December 2017 - Lodged VISA 190 - DIBP
    09 December 2017 - Medical Examination @ Nationwide Makati
    13 December 2017 - NBI Clearance (Hit)
    18 December 2017 - Claimed NBI Clearance
    18 December 2017 - Frontloaded all documents
    21 February 2018 - CO contact - employment reference (which I have already submitted)
    23 February 2018 - First Feedback (suggestion)
    15 March 2018 - Second Feedback (suggestion)
    20 March 2018 - VISA Grant - Thank you God!
    10 September 2018 - IED
    13 December 2018 - Got a job with Big 4 Audit Firm (External Auditor-Senior Associate)
    1 July 2019 - Moved to another audit firm (External/Internal Auditor-Senior Associate)
    14 Jan 2021 - Got an Internal Auditor job in one of the biggeat insurance companies

    Tips on BM: http://pinoyau.info/discussion/6492/migrating-to-australia-with-high-hopes/p16

    For I know the plans I have for you,” declares the Lord, “plans to prosper you and not to harm you, plans to give you hope and a future. (Jeremiah 29:11)

  • joyousmasterjoyousmaster Posts: 90Member
    Joined: Oct 30, 2013
    @Hunter_08 @Jbros woooow sa wakas. congrats guys. happy for you!! ako na lang talaga ang naiiwan. July pa ako haha

    May 2013 - submitted assessment in ACS
    Aug 2013 - got the result. Quite unfavorable due to lack of experience recognized
    Oct 2013 - took IELTS exam. Did not meet the desired score
    Nov 2013 - re-take IELTS exam. Still did not meet the desired score
    Apr 2014 - re-take IELTS exam in the Philippines. Still, failed. I gave up at this point.
    Sep 2015 - submitted another ACS assessment. Decided to pursue again since B and I separated. Para makamove on kuno haha!
    Sep 2015 - got the result with favorable reply. Still assessed under subclass 190 (state dependent) though.
    Apr 2016 - took PTE exam instead. Did not meet required score
    May 2016 - re-take PTE exam. FINALLY! got the desired score!
    May 2016 - Submitted EOI for South Australia
    Jul 2016 - Submitted EOI for New South Wales
    May 2017 - got the invitation to apply for state sponsorship! Thank you God! got approved on the same month
    Jul 2017 - Visa lodge
    Aug 2017 - First CO contact. Asking for B's credentials, Singapore police clearance, etc
    Aug 2017 - Medical
    Sep 2017 - Provided documents
    Nov 2017 - Second CO contact. Asking for more information
    Dec 2017 - Provided documents
    Mar 13, 2018 - Expired passport
    Mar 28, 2018 - Renewed passport
    April 11, submitted new passport
    April 23 - GRANT :) thank GOD!

    JULY 28, 2018 - IED

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @chococrinkle thank you

    @Heprex oo nga mukang hindi nya handle yung 489 pero sya pa din nag reply sa feedback ko..hahaha.. nakulitan na siguro sa akin kasi 5 times na ko nag feedback...hahaha

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @pahpuh @vincechaos @joyousmaster thank you.. hopefully makuha na lahat ng naghihintay pa na na CO contact ang grants

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • heero_yuy51heero_yuy51 manila
    Posts: 182Member
    Joined: Sep 29, 2017
    @Hunter_08 sa wakas! Congrats!

    ANZSCO 351311 - Chef | Age:30 | English: 20 | Education: 10 | Exp (Aus): 5 | Exp: 5 | Aus Study Req: 5 | Total: 75

    29/08/2017 - VETASSESS application pathway 2
    30/09/2017 - IELTS exam
    16/10/2017 - IELTS Result L8.5 R7 S7 W6.5, Recheck
    17/10/2017 - VETASSESS Stage 1 - Successful outcome
    04/11/2017 - IELTS Recheck Result L8.5 R7 S7 W7 Proficient
    12/12/2017 - VETASSESS Stage 2 Technical Interview
    04/01/2018 - VETASSESS - Successful outcome
    05/01/2018 - EOI Lodge 189 - 65 pts
    22/01/2018 - VIC SS190 Application submitted
    23/01/2018 - VIC SS190 Application refused - commitment issues ='p
    23/01/2018 - PTE exam
    24/01/2018 - PTE Result L86 R86 S90 W82 Superior
    25/01/2018 - EOI update - 75 pts
    06/02/2018 - ITA Received
    09/02/2018 - Visa Lodged, Frontloaded Most Documents except for PCC and Medical. Requested PCC from Finland
    12/02/2018 - Commenced Medical Exam at SLEC (St Lukes BGC). Requested PCC from Australia. Requested PCC from Philippines, loaded Philippine PCC to account.
    14/02/2018 - Medical results finalised - no action required
    22/02/2018 - Finnish PCC received, loaded to account
    02/03/2018 - Australian PCC received, loaded to account
    09/07/2018 - Direct Grant c/o Jamie

    “Seek and you shall find”
    Thank you Lord.

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @heero_yuy51 thanks

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • marimarimarimari Australia
    Posts: 107Member
    Joined: Feb 18, 2017
    @joyousmaster ako din wala pa! Hahaha! Sana ne g na tayo.. Congrats @Hunter_08 ! Naka-ilang feedback ka? Waaa naka-kaba naman.. hehe
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @marimari thank you.. naka 5 feedback ako.. at yung huling reply sakin naka indicate na yung 2 previous feedback ko at parang feeling ko nakukulitan na sa akin kaya tinigil ko na...hahahaha.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • OZingwithOZomenessOZingwithOZomeness Kung Saan ang Lahat gusto pumunta sa forum na ito, so alam niyo na yun.
    Posts: 543Member
    Joined: Oct 20, 2017
    wow @Hunter_08 ayun oh.. congrats bro. Enjoy and more grant pa sa mga susunod.
  • siantiangcosiantiangco Batangas City
    Posts: 417Member
    Joined: Oct 24, 2017
    Update

    Name | Lodgement Date | Visa Type | CO Contact Date | CO Requested Info.

    1. @dy3p | Sep 11 | 189 | Oct 17 | Further evidence of employment income in 2008, 2009 (unclaimed points experience) and repeat medical exam (done 5 months prior to lodging) - GRANT RECEIVED (FEB 16) :x
    2. @rvrecabar l Sep 10 l Oct 18 - GRANT RECEIVED (FEB 21) :x
    3. @CroweAltius | Sep 13 | 189 | Oct 23 | Additional Proof of De Facto Relationship - GRANT RECEIVED (FEB 22) :x
    4. @sherwinm | Sep 17 | 189 | Oct 23 | Form 80 and wife’s education certificate - GRANT RECEIVED (FEB 22) :x
    5. @WaterYogi | Sep 07 | 189 | Oct 25 | Form 80, BioData, Evidence of Name Change(though di ako nagbago ng name.) - GRANT RECEIVED (FEB 22) :x
    6. @jacjacjac | Aug 30 | | Oct 25 | Japan Police Clearance, NBI, Daughter’s health clearance (given Dec 12 as per emedical client) - GRANT RECEIVED (FEB 3) :x
    7. @amoj | Sep 20 | 189 | Oct 31 | Further evidence of de facto partnership
    8. @Hunter_08 | Sep 20 | 489 | Nov 1 | Send PTE result to DIBP - GRANT RECEIVED (MAR 6) :x
    9. @dorbsdee l Sep 21 l | Nov 1 l Form 815
    10. @EGMS_AU2017 | Sep 25 | 189 |Nov 6 | main applicant bank statement - GRANT RECEIVED (FEB 22) :x
    11. @eww14 l Sep 23 l | Nov 7 l Evidence of relationship with spouse - GRANT RECEIVED (MAR 5) :x
    12. @siantiangco | Sep 25 | 189 | Nov 10 | further inquiries about GF (non-migrating)
    13. @soddie | Oct 7 | | Nov 14 | Form 815 for daughter, ACS positive assessment for spouse - GRANT RECEIVED (FEB 28) :x
    14. @KimBokJoo | Jul 18 | 189 |1st CO: Aug 21 | 2nd CO: Nov 17 - GRANT RECEIVED (FEB 21) :x
    15. @PMPdreamer | Jul 12 | | 1st CO: Aug 3, Medicals, Police Clearance and PTE | 2nd CO: Nov 24 l Form 815
    16. @Shakespeare23 | July 14 | 189 | 1st CO: Aug 22 : Medicals | 2nd CO: Nov 24: Form 815
    17. @joyousmaster l Jul 23 l |1st CO: Aug 23 l 2nd CO: Nov 24
    18. @mespedido | Oct 11 | 189 | Nov 27 | employment evidence
    19. @rpaid | Aug 10 | 189 | 1st CO: Sep 11| Medicals | 2nd CO: Sep 29 | 3rd CO: Dec 16 - GRANT RECEIVED (FEB 26) :x
    20. @ramon_tubero | Oct 25 | 189 | Jan 09 | Bank statement, UAE PCC, Acad transcripts - GRANT RECEIVED (MAR 5) :x
    21. @Noodles12 l Apr 11 l |1st CO: May 2 l 2nd CO: Aug 10 l 3rd CO: Nov 1 l 4th CO: Jan 17 - GRANT RECEIVED (FEB 21) :x
    22. @bob.ten | Nov 7 | 189 | Jan 23 | Form 815 for daughter - GRANT RECEIVED (FEB 26) :x
    23. @victorious | Nov 21 | 190 | Jan 29 | Main applicant Medical tests
    24. @pahpuh | Nov 9 | 189 | Jan 30 | confirm if information is correct in Form 80 - GRANT RECEIVED (FEB 22) :x
    25. @rj09 | Nov 13 | 189| Feb 1 | Form 815 for my daughter
    26. @UbePandesal | Dec 05 | 190 | Feb 14 | Form80 (Both) , NBI & SG Police Clearance (Husband)
    27. @vincechaos | Dec 05 | 190 | Feb 21 | employment reference (which I have already submitted)
  • siantiangcosiantiangco Batangas City
    Posts: 417Member
    Joined: Oct 24, 2017
  • amojamoj Taguig
    Posts: 157Member
    Joined: Apr 24, 2017
    Congrats @Hunter_08! Kami naman! Hehehe

    263311 Telecommunications Engineer

    Points Total: 75 Points
    Age: 32 - 30 points
    English: Superior - 20 points
    Employment Experience: 5-7 Years - 10 points
    Education: BS Degree: 15 points

    Timeline:
    03/05/2017 - IELTS General Exam (L7.5/R9/W7/S6.5) - 10 Points
    04/11/2017 - Submitted EA Assessment (Fast track)
    05/11/2017 - EA Contact Requesting Change of CDRs
    05/18/2017 - Sent New CDRs
    05/29/2017 - EA Positive Outcome Granted
    05/29/2017 - Submitted EOI (Visa 189) w/ 65 Points
    08/14/2017 - PTE Academic Exam (L82/R90/W90/S90) - increased to 20 Points
    08/16/2017 - Resubmitted EOI (Visa 189) w/ 75 Points
    08/23/2017 - ITA Received!!!
    09/16/2017 - Medicals taken at Nationwide Makati
    09/20/2017 - Visa 189 Lodged
    10/31/2017 - CO Contact requesting for additional supporting documents for de facto partner
    11/03/2017 - Provided needed documents
    03/06/2018 - Grant Received!!!
    04/12/2018 - Big Move to Sydney

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

Andy0625SaundraLatanne.flawsomeREIN24cctvsystemhmacaraniaganne.flawsome.19ellezeugnimarchnparriolaVinceSadlimariannazareno13kkalawCris_ELyster AdamevermontagedcareKrishzan1027masterjonnmsallylumacangchachey8
Browse Members

Members Online (0) + Guest (112)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌