Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

September 2017 Visa 189/190/489/457

14950515355

Comments

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @emcee you cna create you HAP ID by creating immiaccount and health declaration para makauha ka ng HAP ID.. normally ginagawa is after ma received yung ITA nagpapa medical na agad before lodging visa para sure na walang health problem pero yung iba nag lodge na ng visa then pa medical right after before CO contact.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • emceeemcee quezon city
    Posts: 63Member
    Joined: Jan 03, 2018
    @Hunter_08 sir thank you sa response, ask ko lang po, upon lodgement ko po ba makukuha ang HAP ID ko, if unahin ko po ang maglodge kesa sa medical? may mga nagssabe po kasi na yung sa kanila nadetect ang old HAP ID nila kaya d cla inask for a new medical but upon CO contact nirequire cla. btw, december 2016 po ung medical ko.
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @emcee ah you mean may HAP ID ka na at nakapag medical ka na last 2016? not sure kung makakapag medical ka pa using that HAP ID if hindi ni ask ni CO.

    kung wala ka pang HAP ID makukuha mo yun once na nag create ka ng health declaration mo pwede mo yun gawin before lodging the visa or right after mag lodge ng visa.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • jazmyne18jazmyne18 Singapore
    Posts: 574Member
    Joined: Jul 04, 2017
    @emcee hi! Kung may HAP ID ka na, pwede na yata yan. Kasi nakalink naman yan sa account mo. If wala pa, after mo maglodge, punta ka sa health summary yata yun, ng lodgement mo tapos may sasagutan ka lang na medical history, saka mo makukuha ung HAP ID mo after lodgement.

    MAIN APPLICANT: Husband

    2016 07 16 - IELTS Exam
    2016 07 26 - IELTS Result: PROFICIENT <3
    2017 09 11 - EA Assessment [Fast Track]
    2017 09 29 - EA Assessment Outcome: COMPETENT <3
    2017 09 30 - EOI
    2017 10 04 - ITA <3
    2017 11 03 - Lodged Visa 189
    2018 01 15 - Counting ends here, after 73 days: VISA GRANT <3

  • emceeemcee quezon city
    Posts: 63Member
    Joined: Jan 03, 2018
    @Hunter_08 @jazmyne18 ayun!!! hihi! thank you po, balak ko po kasi idelay ang medical ko gawa ng nagttreatment po ako para sa extrapulmonary tb, okay lang po ba idelay kahit mga 1 month? March 31 pa po kasi matatapos ang gamutan ko.
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @emcee pwede naman kasi usually matagal naman magkaron ng CO contact e so ayos lang na ma delay yung medical mo.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • emceeemcee quezon city
    Posts: 63Member
    Joined: Jan 03, 2018
    @Hunter_08 thank you so much po sa reply!
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    mga ka batchmate I got the grant this morning.. God Bless us all.. :D

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • EGMS_AU2017EGMS_AU2017 Singapore
    Posts: 439Member
    Joined: Sep 19, 2017
    @Hunter_08 wow!!! Congrats!!ayan na buhos na
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @EGMS_AU2017 thank.. oo sana tuloy tuloy na pagbibigay nila ng mga grants.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • agdagd Singapore
    Posts: 773Member
    Joined: Jun 12, 2017
    @Hunter_08 congrats sir! :)

    261312 Developer Programmer - (English - 20pts | Age - 30pts. | Qualification - 10 | Experience - 0 ) = 60pts.

    Subclass 189 - 60pts.
    Subclass 190 - (60 + 5 spouse points + 5 SN) = 70pts.

    08/04/2016 - Took IELTS - L/R/W/S - 6.5/7/6.5/7 - Competent
    05/17/2017 - PTE Mock A - L/R/W/S - 74/62/66/76
    05/19/2017 - PTE Mock B - L/R/W/S - 76/70/72/89
    05/30/2017 - PTE Take 1 - L/R/W/S - 79/75/78/78 - Proficient
    06/06/2017 - PTE Take 2 - L/R/W/S - 82/87/90/88- Superior - Thank you, Lord! :)

    PTE Tips: http://pinoyau.info/discussion/4233/pte-academic/p465#Comment_245887

    06/14/2017 - Collection of docs for ACS Assessment
    06/21/2017 - Submitted ACS Assessment
    08/14/2017 - ACS Result Positive. Equivalent to AQF Associate Degree. 5 years experience deducted.
    08/15/2017 - Gathering docs for spouse points (VETASSESS)
    08/22/2017 - Lodged spouse's VETASSESS
    10/05/2017 - VETASSESS results positive - aquired 5pts. for 190
    10/07/2017 - Submitted EOI - 189, 190-NSW, 190-VIC
    10/20/2017 - ITA NSW Received!
    10/22/2017 - Submitted NSW Application
    11/28/2017 - NSW SS Approved! Received ITA for visa 190

    ---------------Gathering docs for visa lodge---------------

    -------------------- Christmas Break --------------------

    01-19-2018 - Visa lodge, SG eAppeal
    01-23-2018 - SG eAppeal Approved
    01-25-2018 - Wife's SG eAppeal Approved
    02-03-2018 - Medical - wife and me
    02-05-2018 - Medical - kids
    02-08-2018 - Medical - Daughter - IGRA
    02-14-2018 - Form 815 Health Undertaking for daughter
    04-27-2018 - 1st CO Contact: Parental Consent/Form 1229
    05-22-2018 - 2nd CO Contact: Wife's Statutory Declaration
    08-21-2018 - 3rd CO Contact: Repeat Medical - Daughter
    09-21-2018 - VISA GRANT! Thank you Lord!

    11-11-2018 - IE (Medicare, Centrelink, NSW DL)
    April 2019 - Target BM with wife
    January 2020 - Target BM - 3 kids

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @agd thanks sir... good luck sa application hopefully bumilis process para makuha nyo na din yung grant.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • toperthugtoperthug Singapore
    Posts: 202Member
    Joined: Sep 20, 2017
    @Hunter_08 friend finally!!! after in heprex ikaw ang inaabangan ko dito
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @toperthug salamat friend..heheheh... kamusta application mo?

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • agdagd Singapore
    Posts: 773Member
    Joined: Jun 12, 2017
    @Hunter_08 salamat sir! dun din naman tayo papunta lahat! Goodluck sa BM. malapit lapit na. :)

    261312 Developer Programmer - (English - 20pts | Age - 30pts. | Qualification - 10 | Experience - 0 ) = 60pts.

    Subclass 189 - 60pts.
    Subclass 190 - (60 + 5 spouse points + 5 SN) = 70pts.

    08/04/2016 - Took IELTS - L/R/W/S - 6.5/7/6.5/7 - Competent
    05/17/2017 - PTE Mock A - L/R/W/S - 74/62/66/76
    05/19/2017 - PTE Mock B - L/R/W/S - 76/70/72/89
    05/30/2017 - PTE Take 1 - L/R/W/S - 79/75/78/78 - Proficient
    06/06/2017 - PTE Take 2 - L/R/W/S - 82/87/90/88- Superior - Thank you, Lord! :)

    PTE Tips: http://pinoyau.info/discussion/4233/pte-academic/p465#Comment_245887

    06/14/2017 - Collection of docs for ACS Assessment
    06/21/2017 - Submitted ACS Assessment
    08/14/2017 - ACS Result Positive. Equivalent to AQF Associate Degree. 5 years experience deducted.
    08/15/2017 - Gathering docs for spouse points (VETASSESS)
    08/22/2017 - Lodged spouse's VETASSESS
    10/05/2017 - VETASSESS results positive - aquired 5pts. for 190
    10/07/2017 - Submitted EOI - 189, 190-NSW, 190-VIC
    10/20/2017 - ITA NSW Received!
    10/22/2017 - Submitted NSW Application
    11/28/2017 - NSW SS Approved! Received ITA for visa 190

    ---------------Gathering docs for visa lodge---------------

    -------------------- Christmas Break --------------------

    01-19-2018 - Visa lodge, SG eAppeal
    01-23-2018 - SG eAppeal Approved
    01-25-2018 - Wife's SG eAppeal Approved
    02-03-2018 - Medical - wife and me
    02-05-2018 - Medical - kids
    02-08-2018 - Medical - Daughter - IGRA
    02-14-2018 - Form 815 Health Undertaking for daughter
    04-27-2018 - 1st CO Contact: Parental Consent/Form 1229
    05-22-2018 - 2nd CO Contact: Wife's Statutory Declaration
    08-21-2018 - 3rd CO Contact: Repeat Medical - Daughter
    09-21-2018 - VISA GRANT! Thank you Lord!

    11-11-2018 - IE (Medicare, Centrelink, NSW DL)
    April 2019 - Target BM with wife
    January 2020 - Target BM - 3 kids

  • amojamoj Taguig
    Posts: 157Member
    Joined: Apr 24, 2017
    Guys, got my grant today as well.

    263311 Telecommunications Engineer

    Points Total: 75 Points
    Age: 32 - 30 points
    English: Superior - 20 points
    Employment Experience: 5-7 Years - 10 points
    Education: BS Degree: 15 points

    Timeline:
    03/05/2017 - IELTS General Exam (L7.5/R9/W7/S6.5) - 10 Points
    04/11/2017 - Submitted EA Assessment (Fast track)
    05/11/2017 - EA Contact Requesting Change of CDRs
    05/18/2017 - Sent New CDRs
    05/29/2017 - EA Positive Outcome Granted
    05/29/2017 - Submitted EOI (Visa 189) w/ 65 Points
    08/14/2017 - PTE Academic Exam (L82/R90/W90/S90) - increased to 20 Points
    08/16/2017 - Resubmitted EOI (Visa 189) w/ 75 Points
    08/23/2017 - ITA Received!!!
    09/16/2017 - Medicals taken at Nationwide Makati
    09/20/2017 - Visa 189 Lodged
    10/31/2017 - CO Contact requesting for additional supporting documents for de facto partner
    11/03/2017 - Provided needed documents
    03/06/2018 - Grant Received!!!
    04/12/2018 - Big Move to Sydney

  • agdagd Singapore
    Posts: 773Member
    Joined: Jun 12, 2017
    @amoj congrats! :)

    261312 Developer Programmer - (English - 20pts | Age - 30pts. | Qualification - 10 | Experience - 0 ) = 60pts.

    Subclass 189 - 60pts.
    Subclass 190 - (60 + 5 spouse points + 5 SN) = 70pts.

    08/04/2016 - Took IELTS - L/R/W/S - 6.5/7/6.5/7 - Competent
    05/17/2017 - PTE Mock A - L/R/W/S - 74/62/66/76
    05/19/2017 - PTE Mock B - L/R/W/S - 76/70/72/89
    05/30/2017 - PTE Take 1 - L/R/W/S - 79/75/78/78 - Proficient
    06/06/2017 - PTE Take 2 - L/R/W/S - 82/87/90/88- Superior - Thank you, Lord! :)

    PTE Tips: http://pinoyau.info/discussion/4233/pte-academic/p465#Comment_245887

    06/14/2017 - Collection of docs for ACS Assessment
    06/21/2017 - Submitted ACS Assessment
    08/14/2017 - ACS Result Positive. Equivalent to AQF Associate Degree. 5 years experience deducted.
    08/15/2017 - Gathering docs for spouse points (VETASSESS)
    08/22/2017 - Lodged spouse's VETASSESS
    10/05/2017 - VETASSESS results positive - aquired 5pts. for 190
    10/07/2017 - Submitted EOI - 189, 190-NSW, 190-VIC
    10/20/2017 - ITA NSW Received!
    10/22/2017 - Submitted NSW Application
    11/28/2017 - NSW SS Approved! Received ITA for visa 190

    ---------------Gathering docs for visa lodge---------------

    -------------------- Christmas Break --------------------

    01-19-2018 - Visa lodge, SG eAppeal
    01-23-2018 - SG eAppeal Approved
    01-25-2018 - Wife's SG eAppeal Approved
    02-03-2018 - Medical - wife and me
    02-05-2018 - Medical - kids
    02-08-2018 - Medical - Daughter - IGRA
    02-14-2018 - Form 815 Health Undertaking for daughter
    04-27-2018 - 1st CO Contact: Parental Consent/Form 1229
    05-22-2018 - 2nd CO Contact: Wife's Statutory Declaration
    08-21-2018 - 3rd CO Contact: Repeat Medical - Daughter
    09-21-2018 - VISA GRANT! Thank you Lord!

    11-11-2018 - IE (Medicare, Centrelink, NSW DL)
    April 2019 - Target BM with wife
    January 2020 - Target BM - 3 kids

  • toperthugtoperthug Singapore
    Posts: 202Member
    Joined: Sep 20, 2017
    @Hunter_08 mag IED n ako sa May pero jobhunting pasa pasa CV muna ikaw BM n u?
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @toperthug ako balak ko mag BM sa july pero mag try na din ako mag pasa pasa ng cv baka sakaling may pumansin at ma hire before pa makapunta sa Au. kailan yung BM mo?

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • EGMS_AU2017EGMS_AU2017 Singapore
    Posts: 439Member
    Joined: Sep 19, 2017
    @Hunter_08 pahingi nmn ako ng format ng cv for AU sir. Maguupdate din kami ng cv bago mag BM sa August
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @EGMS_AU2017 nako sir hindi ko sure kung okay tong CV format ko..hahaha...

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • EGMS_AU2017EGMS_AU2017 Singapore
    Posts: 439Member
    Joined: Sep 19, 2017
    @Hunter_08 hahaha iba daw kc ung cv na mabilis mapansin aun sa panlasa ng AU. Baka lang po kau ay meron in future my makita kau pashare nlng po hehehe
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @EGMS_AU2017 sige sige.. yung akin kasi Au format pero hahanap pa din ako ng mas okay na CV samples.

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • EGMS_AU2017EGMS_AU2017 Singapore
    Posts: 439Member
    Joined: Sep 19, 2017
    @Hunter_08 cge po matagal pa nmn ang BM namin. Madami pa aasikasuhin hehe
  • toperthugtoperthug Singapore
    Posts: 202Member
    Joined: Sep 20, 2017
    @Hunter_08 Big Move ko depende kung anu magiging resulta ng IED ko sa May, nerbyos much n nga ako
  • toperthugtoperthug Singapore
    Posts: 202Member
    Joined: Sep 20, 2017
    @Hunter_08 sure ka n july? may plano sila ireform yung migration sa time n yan, yung plano nila i-extend yung waiting time to 3 years instead of 2 years para sa benefits pag July nagland. kaya me napabook ng May dahil
    para makaiwas sa plano nilang reform
  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @toperthug what do you mean benefits? kasi alam kong binago nila si for visa 457 na instead na 2yrs bago pwede e convert sa pr gagawin nilang 3yrs yan yung alam kong changes

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @Hunter_08. Eto din nabasa ko baka eto rin nabasa ni @toperthug. Worried din ako esp that were in 489 visa. Mukhang pahirapan nila talaga new migrants ah. Andaming new rules for july 2018. Hopefully changes wont be too drastic.

    https://www.theguardian.com/australia-news/2018/mar/01/plan-to-make-it-harder-for-migrants-to-get-benefits-to-affect-110000-children

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • Hunter_08Hunter_08 Adelaide
    Posts: 2,130Member
    Joined: Mar 01, 2011
    @chococrinkle thanks for the info.. mukang mahirap nga to though hindi pa naman ata finalized. I'll consider to move by end of june instead of july para makaiwas dyan...heheheh

    Apr 26, 2013 ACS Result- Suitable
    Feb 21,2013 Submitted ACS online assessment - Software Tester


    May 9, 2016 PTE Exam Result L/R/S/W- 71/69/83/72 Passed Thank you Papa Jesus
    Aug 18,2016 ACS Result- Suitable -Software Engineer
    Aug 19, 2016 Lodged EOI for subclass 190
    July 13, 2017 Lodged EOI and Submitted Application for subclass 489
    Aug 12, 2017 ITA Received
    Aug 25,2017 Scheduled Medical Test
    Aug 28, 2017 Medical Cleared(No Action Required)
    Aug 30, 2017 NBI Clearance PH
    Sept 15, 2017 SG COC Fingerprint and Collection
    Sept 20, 2017 Visa Lodge
    Nov 1, 2017 CO Contact (Requesting to Send PTE Score Report to DIBP which I already did before)

    Mar 6, 2018 Visa Grant


    Visa 887 Timeline

    July 25, 2020 Visa Lodge
    Oct 12, 2020 Visa Grant


    Citizenship Timeline
    July 4, 2022 Submitted Citizenship Application
    Dec 21, 2022 Invitation for Exam(Need to reschedule the exam)
    Feb 21, 2023 Citizenship Exam
    April 3, 2023 Received Approval Letter
    June 22, 2023 Citizenship Ceremony


    *****Dream big, think positive and Pray to God*****

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @Hunter_08. I hope this major change will not push through. If we receive our visa in a few weeks, our plan is si hubby muna mauna to look for a job by June, so most probably me and the kids will move by Dec pa. If that will take effect in 2018, I dont know whats the impact for 489 visa holders. The most we could do is to ensure that hubby gets a stable job before the rest of us move. Im praying hard for positive things to happen. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

iamnadygeulia24Andy0625SaundraLatanne.flawsomeREIN24cctvsystemhmacaraniaganne.flawsome.19ellezeugnimarchnparriolaVinceSadlimariannazareno13kkalawCris_ELyster AdamevermontagedcareKrishzan1027masterjonnm
Browse Members

Members Online (0) + Guest (134)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌