Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

General Skilled Immigration Visa - Step By Step Process

1262263265267268475

Comments

  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011
    edited February 2018
    @Krisian tick mo lng 190. kasi process ni NSW pipili sila from the EOI na na lodge sa DIBP tsaka sila iinvite depending on your points

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • toAustraliaandbeyondtoAustraliaandbeyond Philippines
    Posts: 95Member
    Joined: Feb 13, 2018
    Question po kung kami ni hubby mag migrate pero ako main applicant need nya din po ba mag take ng english test nsa abroad kasi xa now eh and anu po ba iba pang need if may ksama po ung spouse sa application salamat po
  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011
    @toAustraliaandbeyond kong mag claim ka ng partners skill points, which needs assessment too, and assessment dapat may English test, then yes.

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • toAustraliaandbeyondtoAustraliaandbeyond Philippines
    Posts: 95Member
    Joined: Feb 13, 2018
    @batman tama po ba pagkakaintindi ko, so kung dependent ko lang po sya, no need n po. Pero if ever na nsa Visa application stage na po, may extrang bayad pa din po ba xa or wala na po? Salamat po sa info pra po alam n nmin magkanu po iipunin nmin.
  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011
    @toAustraliaandbeyond may bayad ang dpendents pag lodge na ng visa application.

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • toAustraliaandbeyondtoAustraliaandbeyond Philippines
    Posts: 95Member
    Joined: Feb 13, 2018
    @batman salamat sa information.
  • cuccicucci NSW
    Posts: 981Member
    Joined: Jan 27, 2018
    @toAustraliaandbeyond even as dependent may requirement na proof of functional english.

    https://www.aussian.com/getting-evidence-functional-english/

    How To Prove Your Functional English?
    DIBP requires you to furnish either of the two documents as a proof of functional English competency for your partner

    Average IELTS score of 4.5 /TOEFL iBT minimum score of 32/ PTE Academic score of 30/ Cambridge English Advanced test(CAE) minimum score of 147
    Letter from institution or university stating that you have completed the full-time degree, diploma or trade certificate and all instructions were in English
    If you don’t provide either of this, you have to pay additional amount, presently it comes to around $4885. Since I wanted to save time and money, I didn’t want to go through IELTS route for my wife. So the only option was to contact her university and get the functional English letter.

    ++++++++++++++++++++++++
    07.2016 | IELTS
    01.2017 | Applied to AHPRA
    04.2017 | received Letter of Referral
    09.2017 | finished BP
    11.2017 | AHPRA Registration / Employment Offer
    12.2017 | Lodged 457 Visa Application (onshore) / ANMAC Assessment
    01.2018 | 457 Visa granted / Received positive ANMAC Assessment / Submitted EOI

    04.11.2019 | Received Employer Nomination
    04.26.2019 | Submitted Visa application (186 DE)
    05.06.2019 | CO contact for medical exams
    05.09.2019 | Visa Granted (186 DE)

    17.09.2021 | Application for Citizenship
    21.03.2022 | Citizenship exam, interview and approval
    02.07.2022 | Citizenship Ceremony
    (Thank you Lord!!!)

    21.03.2023 | Citizenship interview, exam and approval of dependents
    ++++++++++++++++++++++++

  • toAustraliaandbeyondtoAustraliaandbeyond Philippines
    Posts: 95Member
    Joined: Feb 13, 2018
    @cucci i see.. Is this applicable only during the visa processing? How about during the skill assesment? Hubby is currently overseas sea-based pa so impossible makapagtake xa ng exams. If sa CPAA plang need n nito then I guess I have to put my application on hold.
  • cuccicucci NSW
    Posts: 981Member
    Joined: Jan 27, 2018
    @toAustraliaandbeyond Sorry am not versed with the skills assessment process sa ibang profession... however sa ANMAC di man kinonsider ang partner/dependent.

    AFAIK, yung functional english requirement is for the visa if main applicant is not claiming additional points for partner skills. Pero kung mag-claim parang competent na or higher ang requirement.

    ++++++++++++++++++++++++
    07.2016 | IELTS
    01.2017 | Applied to AHPRA
    04.2017 | received Letter of Referral
    09.2017 | finished BP
    11.2017 | AHPRA Registration / Employment Offer
    12.2017 | Lodged 457 Visa Application (onshore) / ANMAC Assessment
    01.2018 | 457 Visa granted / Received positive ANMAC Assessment / Submitted EOI

    04.11.2019 | Received Employer Nomination
    04.26.2019 | Submitted Visa application (186 DE)
    05.06.2019 | CO contact for medical exams
    05.09.2019 | Visa Granted (186 DE)

    17.09.2021 | Application for Citizenship
    21.03.2022 | Citizenship exam, interview and approval
    02.07.2022 | Citizenship Ceremony
    (Thank you Lord!!!)

    21.03.2023 | Citizenship interview, exam and approval of dependents
    ++++++++++++++++++++++++

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @toAustraliaandbeyond. If you mean for YOUR skills assessment purposes, you want ti know if need ng husband nyo mag English test, then its not needed. You can proceed with your skills assessment. However, during visa application you need to provide proof that your husband has functional English. He may not take the English test if he can provide Certificate of English as Medium of Instruction. You may ask that from his college or university. Also, if ever you will claim partner skills points (if his occupation is of the same list as yours), then he needs to take English test and skills assessment. Hope that helps.

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • RheaMARN1171933RheaMARN1171933 Posts: 2,822Member, Administrator, Moderator
    Joined: Mar 10, 2016
    @toAustraliaandbeyond applicants from countries with English as not the first language are required to demonstrate English skills
  • cuccicucci NSW
    Posts: 981Member
    Joined: Jan 27, 2018
    @RheaMARN1171933 hi Maam Rhea... can you expound a bit on " Your partner’s nominated skilled occupation must be on the same skilled occupations list as your nominated skilled occupation."

    Been trying to understand what it means... salamat po ng marami.

    ++++++++++++++++++++++++
    07.2016 | IELTS
    01.2017 | Applied to AHPRA
    04.2017 | received Letter of Referral
    09.2017 | finished BP
    11.2017 | AHPRA Registration / Employment Offer
    12.2017 | Lodged 457 Visa Application (onshore) / ANMAC Assessment
    01.2018 | 457 Visa granted / Received positive ANMAC Assessment / Submitted EOI

    04.11.2019 | Received Employer Nomination
    04.26.2019 | Submitted Visa application (186 DE)
    05.06.2019 | CO contact for medical exams
    05.09.2019 | Visa Granted (186 DE)

    17.09.2021 | Application for Citizenship
    21.03.2022 | Citizenship exam, interview and approval
    02.07.2022 | Citizenship Ceremony
    (Thank you Lord!!!)

    21.03.2023 | Citizenship interview, exam and approval of dependents
    ++++++++++++++++++++++++

  • toAustraliaandbeyondtoAustraliaandbeyond Philippines
    Posts: 95Member
    Joined: Feb 13, 2018
    @RheaMARN1171933 @chococrinkle @cucci thank you for the replies. Mejo mas clear na sa akin. Another question sorry and dami lubusin ko na ung payment b ng $3670 aud ba un sa pag submit plang ba un ng visa or once n magrant? Thank you.
  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @toAustraliaandbeyond. You will pay once you lodge your visa. Pls note if you include your partner/dependents there will be additional fee. You may check with the dibp website for the fees.

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • toAustraliaandbeyondtoAustraliaandbeyond Philippines
    Posts: 95Member
    Joined: Feb 13, 2018
    edited February 2018
    @chococrinkle dapat ba pag nag lodge ako ng visa application ksama na ung proof of functional english ni hubby? Or pdeng to follow.. Mejo matagal pa kasi uwi nya(Oct) so mtagal p bgo xa makapag take ng exam. Mukhang d kami mkakakuha sa school nya eh ng proof ng functional englishkasi 1 sem lng xa dun nag ofw n xa.
  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @toAustraliaandbeyond. Well you can lodge the visa then to follow uploading of documents. However if your docs are not complete you will have CO contact asking for lacking docs, so better na complete na. Your husband also needs to undergo medical exam. Matagal pa ba sya mkakauwi?

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • toAustraliaandbeyondtoAustraliaandbeyond Philippines
    Posts: 95Member
    Joined: Feb 13, 2018
    @chococrinkle yes.. October pa this year ang pinakamaaga nyang uwi. Ang medical pob nmin both is dapat before submission of Visa? Sorry sobrang wala akong idea dami ko tuloy tanung.
  • toAustraliaandbeyondtoAustraliaandbeyond Philippines
    Posts: 95Member
    Joined: Feb 13, 2018
    @chococrinkle thank yoy pla sa reply nabasa ko na sa site na ang medical pla is preferred nila before the visa application. Ty
  • noahutznoahutz Philippines
    Posts: 17Member
    Joined: Aug 25, 2016
    hello po. ask lang po ako kung may case similar sa amin.

    24 Sep 2017 - Submitted health documents
    - Me and Wife -> Health clearance provided – no action required
    - Son -> Examinations in progress (Primary complex treatment pa po sya until May 2018)
    08 Oct 2017 - Application submitted
    08 Oct 2017 - Application fee paid

    Application Mailbox
    08 Oct 2017 - IMMI Acknowledgement of Application Received
    27 Nov 2017 - IMMI Assessment Commence

    Question po is since *Examination in progress* pa po yung sa son namin, di pa po ba mag progress yung application namin? Until now po kasi yan lang natatanggap namin sa application mailbox at not sure kung CO Contact yan.

    Salamat po in advance.
  • izzamrgizzamrg AU
    Posts: 208Member
    Joined: Sep 11, 2017
    edited February 2018
    Hello po. May nakakaalam po ba if possible makahingi ng copies ng ITR sa BIR? wala po kasi akong copy ng payslips and all I have is SSS stat and COE for a job na hindi ako nagclaim ng points for.

    Tapos for the job i claimed points for, I have SSS stat, COE, reference letter, and ANMAC assessment. No payslips and ITR din, for which I'll submit a stat dec. Sapat na po kaya yun? Thanks sa sasagot!

    254499 - Registered Nurse (nec) | Age: 30 | Education: 15 | Experience: 5 | English: 20 | State Sponsorship: 5 | Total: 75

    05/2017 - ANMAC Assessment
    29/08/2017 - ANMAC Outcome
    30/08/2017 - EOI 190 NSW (60pts)
    12/01/018 - PTE-A (Superior) | EOI Update (75pts)
    02/02/18 - ITA for Nomination NSW
    12/02/2018 - Approval of NSW Nomination | ITA
    15/03/2018 - 190 NSW Visa Lodge
    29/05/2018 - CO Contact - Proof of AU Citizenship of Spouse; Consent to disclosure of information PCC NZ; PCC Philippines; Further employment evidence
    08/06/18 - Responded to CO Contact
    07/11/18 - PR SC190 Granted
    29/05/23 - Submitted Citizenship Application
    27/06/23 - Received schedule for Citizenship interview and test
    07/07/23 - Citizenship interview and test + Notification of approval of Australian citizenship

  • nnanni01nnanni01 Posts: 41Member
    Joined: Jun 20, 2017
    @archdreamchaser nde pa nga po need kasi ni hubby pcc sa dubai, currently asa pinas cya kaya nde k pa sure ung process nkita k lng sa site na need nbi fingerprint tas pa authenticate po sa dfa tas courier sa uae embassy.
  • NoelRubioNoelRubio Philippines
    Posts: 132Member
    Joined: Sep 12, 2017
    Hello guys,

    May question lang po. Anyone can answer po.

    Ask lang ako ng confirmation from you guys.

    When it comes to submission ng EOI for NSW (visa 190), there's no need to apply to the NSW website to ask for nomination, tama po ba? Does the NSW select from EOI straight away and no need to apply online sa NSW website for a nomination?

    Kasi sa mga nababasa ko: "The client should contact the State or Territory they are interested in receiving nomination from." I guess this is true to other states like VIC and NT, but not to NSW. Tama po ba?

    Good day to all

    :)

    October 13, 2017 = Submitted requirements to ACS for Skills Assessment
    October 23, 2017 = Enrolled in Review Training Center for Pearson English Exam (PTE)
    November 22, 2017 = Took Pearson English Exam (PTE)
    November 23, 2017 = Got Pearson Exam Results. (L-88 | R-82 | S-83 | W-90) (Result = Superior)
    November 28, 2017 = Received ACS Skills Assessment Result. (Result = Suitable)
    November 30, 2017 = Submitted EOI. (189 | 75 | 261312 Developer Programmer)
    December 12, 2017 = EOI was adjusted. (189 | 70 | 261312 Developer Programmer)
    February 19, 2018 = Submitted EOI. (190 NSW | 75 | 261312 Developer Programmer)
    February 25, 2018 = Submitted EOI. (190 VIC | 75 | 261312 Developer Programmer)
    March 2, 2018 = Pre-invited to apply for NSW nomination.
    March 4, 2018 = Submitted application for NSW nomination.
    March 20, 2018 = Pre-invited to apply for VIC nomination.
    March 27, 2018 = Submitted application for VIC nomination.
    May 11, 2018 = Received nomination and ITA 190 NSW.
    May 18, 2018 = Got NBI Clearance.
    May 25, 2018 = Lodged Visa 190 NSW.
    May 28, 2018 = Attached ALL applicable docs except medical.
    May 29, 2018 = Had medical in St. Lukes Global City
    September 10, 2018 = VISA DIRECT GRANT!!! Thank you Lord!
    September 25, 2018 = CFO / PDOS
    March 6, 2019 = Initial Entry
    May 30, 2019 = Big Move

    =======================

    Romans 12:12 Rejoice in hope, be patient in tribulation, be constant in prayer.

    James 5:7-8 Be patient, therefore, brothers, until the coming of the Lord. See how the farmer waits for the precious fruit of the earth, being patient about it, until it receives the early and the late rains. You also, be patient. Establish your hearts, for the coming of the Lord is at hand.

    Proverbs 3:5-6 Trust in the LORD with all your heart, and do not lean on your own understanding. In all your ways acknowledge him, and he will make straight your paths.

  • ChewChew Cainta
    Posts: 3Member
    Joined: Feb 19, 2018
    Hi. I am so newbie here at nangangalap plang po ng information kung pano mag apply. Ask ko lang ano po mas better, mag apply directly sa Australian embassy or kumuha ng agent? Hope someone will give me more details kasi as of now, nao-ovewhelmed kami masyado ng husband ko sa process na nabasa namen online. Nakakalito po kasi
  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011
    @Chew its all up to you actually. if you have the luxury of time. and masipag kau mag research at magbasa kaya nyo gawin ng sarili nyo lng. If kong busy ka naman to do the research, kasi it really needs a lot of time, better engage sa profession like the agents.

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • batmanbatman Darwin Australia
    Posts: 3,532Member, Moderator
    Joined: Oct 04, 2011
    @NoelRubio you can check directly sa website ng kada state na interested ka mag apply naka indicate doon ang procedure nila.

    221213 External Auditor|489 - 70pts - SS NT
    21|07|16 - Applied CPAA membership assessment
    31|07|16 - PTE-A L|S|W|R (73|79|78|77)
    01|08|16 - Submitted CPAA migration assessment
    20|09|17 - EOI 190 - NT (delayed due to show money req.)
    - collating requirements for NT SS application
    18|10|17 - Submitted NT SS application (praying for + result)
    24|04|18 - 190 not successful,
    - was offered 489 instead and accepted the offer
    - engaged with visa consort agency for visa application submission.
    26|04|18 - Invited to apply for SS visa 489 - Northern Territory
    02|05|18 - PCC processing
    20|05|18 - Medical
    06|06|18 - Visa payment
    15|09|18 - happy na birthday pa, visa grant pa.. TYL
    09|02|19 - Big move
    11|02|19 - First job interview
    12|02|19 - Received a job offer
    13|02|19 - Accepted job offer
    13|08|19 - Accepted a new job offer - new employer
    16|10|20 - Started new job - a better opportunity
    01|01|21 - Started CPA Australia qualification
    10|02|21 - Lodged 887 visa application
    June 2021 - First CPA subject passed
    Nov 2021 - 2nd CPA Subject passed
    June 2022 - 3rd and 4th CPA subject passed
    Nov 2022 - 5th subject passed (failed the other one)
    Feb 2023 - PR visa granted
    June 2023 - Officially a CPA Australia member
    Apr 2024 - Joined the government (employee)
    July 2024 - Citizenship exam & passed
    Nov 2024 - Citizenship Ceremony

  • rurumirurumi Cavite
    Posts: 17Member
    Joined: Feb 19, 2018
    Hello!
    Question lang po, past employee ako ng HP. However, nagchange sila ng name to DXC so my COE and my payslips will have the letterhead of DXC. Then yung ITRs ko, HP parin yung nakalagay. Okay lang po kaya ito kapag pinasa ko sa ACS and for Visa?
    Thank you!
  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    edited February 2018
    @rurumi nung umalis ka ba HP pa din? or DXC na? ako kase na retrieve ko payslips ko sa kanila, pero HPE letterhead pa din. pati generic COE ko HPE letterhead pa din, since past employee ako ng HPE not DXC.

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • rurumirurumi Cavite
    Posts: 17Member
    Joined: Feb 19, 2018
    @Heprex nung umalis po ako HP pa sila kaso hindi ako nakapagtago ng mga payslips ko so naglog ako ng ticket sa HR PDL nila. Ang binigay sakin DXC letterhead na payslips. I'm also having doubts how to make the customized COE, HP yung ilalagay ko na company ko but the letterhead they will provide will be DXC na po diba? Is this okay? Thank you sa pagsagot. :)
  • HeprexHeprex Melbourne
    Posts: 2,109Member
    Joined: Aug 03, 2016
    @rurumi kelan ka nag resign? pede mo retrieve excelity password mo sa kanila, nadun lahat ng payslips at ITR, nasa HPE letterhead pa. dun ko nakuha akin. Need mo mag pa approve sa manager ng Roles and Responsibilities mo, bago ka gawan ni HP ng COE with R&R. ginawa ko is generic COE na lang, tapos affidavit from former colleague.

    263111 - Computer Network and Systems Engineer | Age: 30pts | Education: 15pts | Experience: 5pts | English: 20pts | Total: 70pts
    .
    03.08.2016 - joined pinoyau forum
    12.08.2016 - Start collating documents needed for ACS assessment.
    17.11.2016 - CTC'd and Submitted online ACS Assessment.
    28.11.2016 - ACS Result Suitable (AQF Advance Diploma, 5 years deducted) - Sent Appeal Application
    05.12.2016 - ACS Appeal Successful (AQF Bachelor Degree, 2 years deducted)
    21.12.2016 - Submitted EOI 189/190(NSW) (60/65)
    07.09.2017 - Update EOI 189 to 70pts
    20.09.2017 - INVITED!!!
    02.10.2017 - NBI Appointment - Hit for Wifey
    09.10.2017 - Medical @ Nationwide Makati - NBI Release for Wifey
    10.10.2017 - Medical Cleared (Both) - Visa 189 Application Lodge - Frontloaded All Documents
    20.02.2018 - GRANTED!! FINALLY!!! 02 Oct 2018 IED
    *****AFTER GRANT*****
    20.03.2018 - CFO/PDOS
    28.05.2018 - Initial Entry
    31.07.2018 - Big Move (Melbourne)
    .
    Days Count since Lodging: 133 days - counting ends here!!
    .

    CITIZENSHIP TIMELINE

    Date applied: 06 July 2022
    City/Council area: City of Maroondah (VIC)
    Online / Paper: Online
    Date received the acknowledgement email: 06 July 2022
    Received Citizenship Interview & Test Appointment letter: 09 Feb 2023
    Date of the Citizenship Test: 15 Feb 2023
    Citizenship Approval: 15 Feb 2023
    Received Ceremony Invitation: 08 May 2023
    Date of ceremony: 07 June 2023
    .
    .
    Road to Superior:
    20.12.2016 - L68/R70/S83/W65
    16.01.2017 - L63/R74/S80/W59
    *****wedding preps*****
    26.06.2017 - L61/R75/S82/W72
    05.07.2017 - L71/R90/S83/W74
    24.07.2017 - L78/R82/S88/W80 - DAMN!!!
    01.08.2017 - L72/R78/S88/W70
    08.08.2017 - L73/R90/S90/W73
    14.08.2017 - L73/R81/S84/W83
    **********Haitus********
    06.09.2017 - L89/R88/S90/W81 - YEEEEYYYY!!!!
    .
    .
    Mock Test:
    16.12.2016 - Set A - L71/R58/S56/W64
    17.12.2016 - Set B - L73/R61/S71/W67
    .
    .
    List of documents I submitted: (updated Feb 2018) http://pinoyau.info/discussion/comment/282889/#Comment_282889
    Tip #TeamFeedback: http://pinoyau.info/discussion/comment/282580/#Comment_282580
    Sample recording: https://app.box.com/s/au3bmauev40mvffwdq3fvrrd59yqqs1w
    My PTE tips: http://pinoyau.info/discussion/comment/257891/#Comment_257891
    PTE Resources:
    https://drive.google.com/folderview?id=0B2kJYAKd2peiNUMwU01IQ1Z2djA&usp=sharing
    http://pinoyau.info/discussion/6364/pte-review-materials/p1
    ptestudy.com
    http://thevsquare.blogspot.com/
    .
    .
    Are you into stock market investing? Are you looking to invest in US stock Market? Are you OZ citizen or a PR already in OZ?
    I recommend using Stake App to get into US market. It has $0 brokerage fee, and no commission. Just pay the FOREX rate when you transfer funds to your AU to US Stake App. You can earn Free stock if you use my referral code below:
    .
    Invest in US Stocks and ETFs on Stake. Join today using my referral code jeffrexo362 and we can both get a free stock.
    .
    https://hellostake.com/au/referral?referrer=jeffrexo362
    .
    .
    11:11

  • rurumirurumi Cavite
    Posts: 17Member
    Joined: Feb 19, 2018
    @Heprex 2014 ako nagresign. Yes, binigyan nila ako access don sa excelity site pero nung dinownload ko DXC na nakalagay.

    I see. Plan ko kasi pa-sign sa former manager ko then ask sa HR if pwede nila ilipat sa with company letterhead.

    If you don't mind me asking, done kana sa ACS?
Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

mastersifuzindylittlemissarchiGenaGerstaReubenRandbluerainpatcwdesignermaryannkentrodriguezAdelainetormisMarilynjee_lagmanJMEAJbrosnanurzeYanikomisisbSybilGrimlAntBugjoymar
Browse Members

Members Online (0) + Guest (102)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌