Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

VETASSESS Skills Assessment Expires Soon

ieya_ozieya_oz PerthPosts: 74Member
edited January 2014 in Other Migration Topic
Hello guys need your advice please. im waiting for my NSW state sponsorship which was acknowledged last dec 2. the letter says that processing will take 12 weeks pa daw. my problem is yung positive skill assessment ko will expire na by march 12. my question is, do u think if ever i receive an invite before d expiry date, dibp will still process my application? another question, if i receive d invite after march 9 which is the expiry date of my skill assessment, how do i go abt this? please help! thanks!!
«1

Comments

  • maltmalt Mandaluyong
    Posts: 140Member
    Joined: Jun 15, 2012
    Same tayo ng case @ieya_oz malapit na din mag expire by april. sana may sumagot ng topic nato :)

    Main Applicant - Husband

    4/14/2014 - Vetassess "Positive"
    312111 Architectural Draftsperson

    6/25/2016 - IELTS L6.5 R7 W7 S7 (aiming for straight 7 retake ulit - sablay sa Listening)

    7/30/2016 - IELTS L7.5 R7 W7 S7 Thank You Lord


    9/21/16 - lodged Vetassess application "Change of Occupation"
    312112 - Building Associate
    1/23/17 - Vetassess "POSITIVE" 312112 Building Associate
    1/25/17 - Lodge EOI
    1/25/17 - Lodge VIC SS

    "Ask the Lord, to bless your plans, and you will be successful in carrying them out." Proverbs 16:3

  • lock_code2004lock_code2004 Perth
    Posts: 5,037Member, De-activated
    Joined: Feb 23, 2012
    Same tayo ng case @ieya_oz malapit na din mag expire by april. sana may sumagot ng topic nato :)
    If you are waitng for SS, normally pag approved ng SS, within the same dAy mag iinvite na for visa application..

    Kung may active application na kayo for SS, why not contact the state and ask them if they can make the decision before your assessment expiration date..

    Sep 24, 2011 - IELTS (L-8 R-8 W-8 S-7.5 : OBS-8)
    Jan 04, 2012 - EA application submitted | Feb 23, 2012 - EA assessment result (IE ANZSCO 233511)
    May 8, 2012 - Lodged GSM 175 online application | June 4, 2012 - CO Allocated
    June 22, 2012 - Medicals Finalized | Aug 30, 2012 - PCCs Completed (PH, UAE, USA)
    Sep 3, 2012 - Visa Granted (IED Jun 11, 2013) Thank You Lord!
    Oct 16-28, 2012 - Initial Entry Completed - Sydney
    July 28, 2013 - Final move to Perth
    Sep 9, 2013 - Started work with the same company i worked for in UAE/USA
    Oct 28, 2013 - Moved to another company.. ;)

  • bookwormbookworm Canberra
    Posts: 588Member
    Joined: Nov 27, 2013
    edited February 2014
    @malt and @ieya_oz, same problem with me. My vetassess will expire by April 3. My papers are currently awaiting SS, so no problem there. BUT....
    pag nag file na for immigrant visa (190), dun ako mabibitin.

    Have you gotten a reply for this question?

    I just sent an email to vetassess and will let you know what they say.

    According to the site:
    http://www.vetassess.com.au/migrate_to_australia/qa2_faq.cfm#38
    38. What should I do if my positive Skills Assessment is expired?
    Please contact our office via email to migrate@vetassess.com.au. You are required to provide your reference number and we will advise you how you can get your Skills Assessment renewed accordingly.

    20110812 - Submitted Vetassess docs
    20120403 - Received positive assessment
    20130622 - Took the IELTS exam (L:8, R:7, W:8.5, S:8.5, OBS:8)
    20131008 - Created and submitted EOI account
    20131216 - Started gathering documents for ACT SS
    20140113 - Submitted ACT SS nomination
    20140227 - assigned a case officer :)
    20140317 - Finally got my ACT sponsorship!
    20140319 - Invited to apply (visa 190)
    20140325 - Lodged visa 190
    20140718 - Direct visa grant. IED: July 17, 2015
    20150203 - Landed in ACT :) Job hunt begins
    201510 - Started working at Woolies
    20161031 - landed a job in my field as a junior
    20180508 - landed a job in my field

    Thank you God! You are truly amazing!

  • bookwormbookworm Canberra
    Posts: 588Member
    Joined: Nov 27, 2013
    @malt and @ieya_oz, nagreply naman sila kaagad. sabi nila:
    Please fill out the attached SRG03 form to renew your result. The completed form can be returned via email.

    The expiry date will be removed from the reissue.
    Mga AU60 lang yung reissue fee. Buti na lang di kailangan yung buo hehe.

    20110812 - Submitted Vetassess docs
    20120403 - Received positive assessment
    20130622 - Took the IELTS exam (L:8, R:7, W:8.5, S:8.5, OBS:8)
    20131008 - Created and submitted EOI account
    20131216 - Started gathering documents for ACT SS
    20140113 - Submitted ACT SS nomination
    20140227 - assigned a case officer :)
    20140317 - Finally got my ACT sponsorship!
    20140319 - Invited to apply (visa 190)
    20140325 - Lodged visa 190
    20140718 - Direct visa grant. IED: July 17, 2015
    20150203 - Landed in ACT :) Job hunt begins
    201510 - Started working at Woolies
    20161031 - landed a job in my field as a junior
    20180508 - landed a job in my field

    Thank you God! You are truly amazing!

  • ieya_ozieya_oz Perth
    Posts: 74Member
    Joined: Sep 09, 2011
    edited February 2014
    thanks @bookworm! ya, got a reply too! same as what you received.. However, I'm still thinking if now na ako magpapa re-issue or should I wait na muna for my SS outcome which I will most likely receive end of this month... ang most recent na pina process nila now is Nov 11 applicants.. mine was acknowledged in Dec . 2... please advise me also what to do .. thanks!
  • bookwormbookworm Canberra
    Posts: 588Member
    Joined: Nov 27, 2013
    @ieya_oz, ha? from Nov til now ang processing ng SS mo?
    Nako, I submitted mine Jan this year pero dapat within this month makuha ko na din. Bakit ang tagal ng iyo? Sang state ka?

    Sa akin, sinabi ng agent ko na ipa re-issue ko na para ma avoid yung delays pag nag process ako. 60 AU lang naman. Better na maaga ko maayos yung papers kesa ma delay ako sa pag intay ng re-issue. At least ngayon, habang intay ng SS, intay din ng re-issue.

    20110812 - Submitted Vetassess docs
    20120403 - Received positive assessment
    20130622 - Took the IELTS exam (L:8, R:7, W:8.5, S:8.5, OBS:8)
    20131008 - Created and submitted EOI account
    20131216 - Started gathering documents for ACT SS
    20140113 - Submitted ACT SS nomination
    20140227 - assigned a case officer :)
    20140317 - Finally got my ACT sponsorship!
    20140319 - Invited to apply (visa 190)
    20140325 - Lodged visa 190
    20140718 - Direct visa grant. IED: July 17, 2015
    20150203 - Landed in ACT :) Job hunt begins
    201510 - Started working at Woolies
    20161031 - landed a job in my field as a junior
    20180508 - landed a job in my field

    Thank you God! You are truly amazing!

  • ieya_ozieya_oz Perth
    Posts: 74Member
    Joined: Sep 09, 2011
    @bookworm sa NSW ako.. medyo madami silang back log eh.. Dec 2 nila nareceive yung papers ko.. but namention sa acknowledgment letter nila na it will probably take 12 weeks bago ako maka receive ng advice.. anyways, sige ganun na rin gagawin ko.. actually AUD100 sakin kasi kasama PTA.. but that's ok mura pa rin.. i thought kasi ganun nanaman kalaki babayaran tulad nung initial application natin.. thanks a lot! balitaan mo kami :)
  • bookwormbookworm Canberra
    Posts: 588Member
    Joined: Nov 27, 2013
    @ieya_oz, yup, better to have it soon, kesa madelay pag nakuha na.
    Sa ACT SS naman ako.

    20110812 - Submitted Vetassess docs
    20120403 - Received positive assessment
    20130622 - Took the IELTS exam (L:8, R:7, W:8.5, S:8.5, OBS:8)
    20131008 - Created and submitted EOI account
    20131216 - Started gathering documents for ACT SS
    20140113 - Submitted ACT SS nomination
    20140227 - assigned a case officer :)
    20140317 - Finally got my ACT sponsorship!
    20140319 - Invited to apply (visa 190)
    20140325 - Lodged visa 190
    20140718 - Direct visa grant. IED: July 17, 2015
    20150203 - Landed in ACT :) Job hunt begins
    201510 - Started working at Woolies
    20161031 - landed a job in my field as a junior
    20180508 - landed a job in my field

    Thank you God! You are truly amazing!

  • bookwormbookworm Canberra
    Posts: 588Member
    Joined: Nov 27, 2013
    Same tayo ng case @ieya_oz malapit na din mag expire by april. sana may sumagot ng topic nato :)
    If you are waitng for SS, normally pag approved ng SS, within the same dAy mag iinvite na for visa application..

    Kung may active application na kayo for SS, why not contact the state and ask them if they can make the decision before your assessment expiration date..
    @lock_code2004, sorry, ngayon ko lang nakita sagot mo. Nasa ACT SS stage ako but I think I will get my ACT SS before the skills assessment expires. The dilemma is when I lodge for visa 190.

    20110812 - Submitted Vetassess docs
    20120403 - Received positive assessment
    20130622 - Took the IELTS exam (L:8, R:7, W:8.5, S:8.5, OBS:8)
    20131008 - Created and submitted EOI account
    20131216 - Started gathering documents for ACT SS
    20140113 - Submitted ACT SS nomination
    20140227 - assigned a case officer :)
    20140317 - Finally got my ACT sponsorship!
    20140319 - Invited to apply (visa 190)
    20140325 - Lodged visa 190
    20140718 - Direct visa grant. IED: July 17, 2015
    20150203 - Landed in ACT :) Job hunt begins
    201510 - Started working at Woolies
    20161031 - landed a job in my field as a junior
    20180508 - landed a job in my field

    Thank you God! You are truly amazing!

  • maltmalt Mandaluyong
    Posts: 140Member
    Joined: Jun 15, 2012
    @malt and @ieya_oz, nagreply naman sila kaagad. sabi nila:
    Please fill out the attached SRG03 form to renew your result. The completed form can be returned via email.

    The expiry date will be removed from the reissue.
    Mga AU60 lang yung reissue fee. Buti na lang di kailangan yung buo hehe.

    Thanks you so much for sharing this :)

    Main Applicant - Husband

    4/14/2014 - Vetassess "Positive"
    312111 Architectural Draftsperson

    6/25/2016 - IELTS L6.5 R7 W7 S7 (aiming for straight 7 retake ulit - sablay sa Listening)

    7/30/2016 - IELTS L7.5 R7 W7 S7 Thank You Lord


    9/21/16 - lodged Vetassess application "Change of Occupation"
    312112 - Building Associate
    1/23/17 - Vetassess "POSITIVE" 312112 Building Associate
    1/25/17 - Lodge EOI
    1/25/17 - Lodge VIC SS

    "Ask the Lord, to bless your plans, and you will be successful in carrying them out." Proverbs 16:3

  • Newleaf2014Newleaf2014 Adelaide
    Posts: 76Member
    Joined: Oct 06, 2013
    @malt ilang buwan po ba ang effectivity ng skills assessment ng VETASSESS? Ako kasi parating pa lang ung result.

    subclass 573

    August 2013 - initial contact with Aus Bright Educ (agent in Pasig)
    Oct 2013 - Applications to Murdoch, Notre Dame
    9 Nov - IELTS Academic
    19 Nov - Applied to Curtin
    31 Dec - Notre Dame required IELTS 7 in four categories
    20 Jan 2014 - Received 1st offer letter from Curtin
    2 March 2014 - deferred offer from Curtin U to August 2014
    April 2014 - paid tuition fee; submitted financials doc
    May 2014 - paid OSHC (Allianz)
    May 2014 - Cert of placement for kids in WA Educ Dept (free for masteral and doctoral students)
    16 June 2014 - Aus embassy visa app via Australia Bright
    26 June 2014 - Aus Embassy acknowledgement of visa app
    28 June 2014 - NHSI medical exam; results uploaded 3 July
    28 July 2014 - Notice of medicals referred
    Aug 2014 - Health clearance received; requested for deferred enrollment to Jan 2015 due to lack of visa decision
    23 Oct - Visa grant!!!

    "Positive thinking is expecting, talking, believing, and visualizing what you want to achieve. It is seeing what you want, as an accomplished fact."

  • bookwormbookworm Canberra
    Posts: 588Member
    Joined: Nov 27, 2013
    @newleaf2014, 2 years validity nun. :)

    20110812 - Submitted Vetassess docs
    20120403 - Received positive assessment
    20130622 - Took the IELTS exam (L:8, R:7, W:8.5, S:8.5, OBS:8)
    20131008 - Created and submitted EOI account
    20131216 - Started gathering documents for ACT SS
    20140113 - Submitted ACT SS nomination
    20140227 - assigned a case officer :)
    20140317 - Finally got my ACT sponsorship!
    20140319 - Invited to apply (visa 190)
    20140325 - Lodged visa 190
    20140718 - Direct visa grant. IED: July 17, 2015
    20150203 - Landed in ACT :) Job hunt begins
    201510 - Started working at Woolies
    20161031 - landed a job in my field as a junior
    20180508 - landed a job in my field

    Thank you God! You are truly amazing!

  • bookwormbookworm Canberra
    Posts: 588Member
    Joined: Nov 27, 2013
    Nag reply na sa akin Vetassess, nakuha na daw nila application ko and will process it. Will take about 3-4 weeks daw and will send me the physical copy. Di pala cya email copy. hehe. Anyway, oks lang, April pa naman mag expire yung Vetassess ko. saktong sakto lang.

    20110812 - Submitted Vetassess docs
    20120403 - Received positive assessment
    20130622 - Took the IELTS exam (L:8, R:7, W:8.5, S:8.5, OBS:8)
    20131008 - Created and submitted EOI account
    20131216 - Started gathering documents for ACT SS
    20140113 - Submitted ACT SS nomination
    20140227 - assigned a case officer :)
    20140317 - Finally got my ACT sponsorship!
    20140319 - Invited to apply (visa 190)
    20140325 - Lodged visa 190
    20140718 - Direct visa grant. IED: July 17, 2015
    20150203 - Landed in ACT :) Job hunt begins
    201510 - Started working at Woolies
    20161031 - landed a job in my field as a junior
    20180508 - landed a job in my field

    Thank you God! You are truly amazing!

  • PAuljamesPAuljames philippines
    Posts: 11Member
    Joined: Nov 07, 2017
    @bookworm hello po paano po ba proseso ng vetassess? kailangan ko kc magvetassess muna pra sa migration po. salamat
  • bookwormbookworm Canberra
    Posts: 588Member
    Joined: Nov 27, 2013
    @PAuljames Check this site:
    https://www.vetassess.com.au/skills-assessment-for-migration

    Check mo din mga thread dito. Backread. Madami pero helpful :)
    Ano skill mo?

    20110812 - Submitted Vetassess docs
    20120403 - Received positive assessment
    20130622 - Took the IELTS exam (L:8, R:7, W:8.5, S:8.5, OBS:8)
    20131008 - Created and submitted EOI account
    20131216 - Started gathering documents for ACT SS
    20140113 - Submitted ACT SS nomination
    20140227 - assigned a case officer :)
    20140317 - Finally got my ACT sponsorship!
    20140319 - Invited to apply (visa 190)
    20140325 - Lodged visa 190
    20140718 - Direct visa grant. IED: July 17, 2015
    20150203 - Landed in ACT :) Job hunt begins
    201510 - Started working at Woolies
    20161031 - landed a job in my field as a junior
    20180508 - landed a job in my field

    Thank you God! You are truly amazing!

  • PAuljamesPAuljames philippines
    Posts: 11Member
    Joined: Nov 07, 2017
    @bookworm welder po, paano po ba mag apply ng vetassess? may company po ba yan dto sa pinas? o email lng sa kanila documents? thanks
  • PAuljamesPAuljames philippines
    Posts: 11Member
    Joined: Nov 07, 2017
    @bookworm sensya na nalilito po kasi ako paano gagawin nahihilo ako:(
  • RheaMARN1171933RheaMARN1171933 Posts: 2,822Member, Administrator, Moderator
    Joined: Mar 10, 2016
    @PAuljames you need to do further reading on VETASSESS website apart from relying on information here on the forum.
  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @ieya_oz @bookworm pa help po. I have submitted renewal of my skills assessment since nag expire sya last june 2017. Yung employment period na pina assess ko that time was from may 2004 to april 2014. Nag submit ako ng renewal form srg09 with vetassess. Ang concern ko po anong employment period na yung ibibigay nila sa akin? Since we can only claim employment for the last 10 years, sa renewal ba they will indicate na from 2007 to 2017? Same job and employer pa rin ako wlang nagbago. Na confuse kasi ako sa sinasabi sa website nila na parang last 5 years lang ang iconsider? I also sent them an email pero wala pa silang sagot. Id like to ask ano po yung nilagay sa renewal ninyo. Hope you could help. Thanks :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @RheaMARN1171933 pa advise na din please. If nagpa assess ako kay vetassess and I filled up SRG09 form lang yung statement ba nila na sa outcome letter ilalagay ang "revised employment period for the last 5 year", ano big sabihin?. Since sa orig assessment 2004 to 2014 yung sa outcome letter? Ano na yung ilalagay nila sa reneweal ma oitcome letter? Worried kasi ako if makakakuha pa din ako ng 15 points. Included din sa orig outcome letter ko yung points test advise. Thanks

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @RheaMARN1171933 Or if ever magbigay lang ako ng updated coe na im still working up to present on the same company with the same job title as my previous assessment, eill tjat sufficr to claim 15 points? Overall, Im on the same employment from 2003 til present. Thanks

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • heycoachputmeinheycoachputmein australia
    Posts: 40Member
    Joined: Oct 10, 2017
    @chococrinkle i think they can only assess upto 10yrs of work experience. therefore from 2007 to 2017 ang mailalagay sa bago mong assessment letter. I might be wrong, but happy to know what will be the outcome.

    I question that thought process before in cases similar to yours. if same employer , same job, same task ang ginagawa then why they cant assess it from the actual years of employment.
  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @heycoachputmein Thanks for the feedback. Im also hoping they will provide that on my renewed outcome letter. Though as per my sister (already PR in aus), based on some experience, pwede pa din dw ma satisfy ang 10 yrs exp ko when I submit my updated coe. Since same lang naman job and employer then dibp will still honor my 10 years claim with the updated coe, even if below 10 yrs yung assessed years sa skills assessment. I just hope ruling is still the same. Thanks

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • RheaMARN1171933RheaMARN1171933 Posts: 2,822Member, Administrator, Moderator
    Joined: Mar 10, 2016
    @chococrinkle like I mentioned, they will most likely recognise the last 10 years from the time you apply since that's what DIBP will only consider. At the end of the day, there's no point worrying yourself about the outcome. You've submitted your docs, all you have to do is wait and see. Good luck!
  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @RheaMARN1171933. Thanks for clarifying. Yes maybe Im just becoming too worried. Thank you for the inputs. :-)

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • RheaMARN1171933RheaMARN1171933 Posts: 2,822Member, Administrator, Moderator
    Joined: Mar 10, 2016
    @chococrinkle worrying about it won't change anything. It will just drive you crazy for nothing so just wait and respond accordingly when you get the outcome letter.
  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @RheaMARN1171933. hello po Id like to ask again. I already have my renewed skills assessment and have already prepared all needed docs for Visa 489 SA SS. Im with the same company with same job decsription for 14 years and last 2014 I was able to get a coe from them with complate details such as my job description, full time employment salary and manhours indicated. Now I was asking the same letter but hrd informed me they dont issue coe anymore with job description and manhours, they only issue a standard format indicating im a regular employee, position, and my annual salary. I asked my direct superior if I could request a certification from her but she refused as she is not authorized to issue. My question is, would it suffice if I only have the 2014 coe plus the recent one indicating only my position and salary. Also is the term regular employee understood as full time in australia? I hope you could enlighten me. Thanks

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • bookwormbookworm Canberra
    Posts: 588Member
    Joined: Nov 27, 2013
    @chococrinkle sorry for the late reply.
    Would your current coe indicate that you are still in the same position and same company? If yes, I wouldn't worry about it.

    20110812 - Submitted Vetassess docs
    20120403 - Received positive assessment
    20130622 - Took the IELTS exam (L:8, R:7, W:8.5, S:8.5, OBS:8)
    20131008 - Created and submitted EOI account
    20131216 - Started gathering documents for ACT SS
    20140113 - Submitted ACT SS nomination
    20140227 - assigned a case officer :)
    20140317 - Finally got my ACT sponsorship!
    20140319 - Invited to apply (visa 190)
    20140325 - Lodged visa 190
    20140718 - Direct visa grant. IED: July 17, 2015
    20150203 - Landed in ACT :) Job hunt begins
    201510 - Started working at Woolies
    20161031 - landed a job in my field as a junior
    20180508 - landed a job in my field

    Thank you God! You are truly amazing!

  • chococrinklechococrinkle Adelaide
    Posts: 584Member
    Joined: Nov 19, 2017
    @bookworm thank you.

    2014 -- start of Au dream
    06.07.14 -- IELTS LRWS 7.5/7.5/7.0/7.0
    07.18.14 -- positive skills assessment
    08.01.14 -- waiting for occupation in ACT to open
    08.01.15 -- still waiting for occupation in ACT to open
    08.01.16 -- still waiting for occupation in ACT to open
    06.07.17 -- expired IELTS
    07.18.17 -- expired skills assessment
    08.2017 -- learned high points via SA 489
    11.22.17 -- PTE Academic exam LRWS 90/79/90/90
    11.22.17 -- result of Vetassess assessment renewal
    11.30.17 -- EOI lodge SA 489 80 pts
    12.22.17 -- received SA invitation
    01.04.18 -- Visa Lodge SA 489
    01.19.18 -- Medicals
    04.10.18 -- Visa Grant (DG) Praise God!!!


    PTE Writing Tips

    For writing essay I used E2 language format and applying what I learned from Ielts. Sa intro, sa 1st sentence ni restate ko lang yung question using my own words. Then sa 2nd sentence if one sided lang yung question, I give summary of the reasons ( 2 reasons only). Example, if ang essay is about importance of computers (one sided), eto 2nd sentence ko. Computers are valuable resources as they (1st reason) aid in learning and are (2nd reason) used to communicate with others. Then sa 3rd sentence sasabihin ko para pampahaba-- In this essay, I shall discuss my point of view by giving points and examples about the topic.

    Then sa 2nd paragraph, elaborate ko na ang 1St reason. Mga 2 sentences na magsupport sa 1st reason, like if yung 1st reason ko is aid in learning, expand ko ang topic by answering how computers aid in learning,etc. Usually yung reason mo convert mo by asking how, what, when, or who. Tapos sa 3rd sentence, I state examples. Pwede ka din mag add pa ng 4th sentence parang isummarize mo lang ang 2nd paragraph.

    Sa 3rd paragraph discuss naman ang 3rd reason same sa ginawa sa 2nd par.

    4Th paragraph 1st sentence conclusion, then 2nd sentence recommendation.

    If 2 sided naman yung intro pwede mo gamitin yung nasa template like kina Heprex na samples. Then yung 2nd par yung kabilang side, then yung 3rd paragraph yung other side. Tapos same last paragraph.

    If medyo nahihirapan ka sa mga ideas, research ka dito sa forum ng mga recent topics. Tapos based dun sa topic reasearch ka anong pwedeng maging points and reasons para may idea ka na ano ilalagay mo sa essay.

    Ang key talaga sa writing is dapat marami ka ideas. If nahihirapan ka mag construct ng idea try to research as much as possible. Google mo yung mga common or recent topics on pte writing tapos may mga sample questions dun,, then research mo ano possible answers para sa actual exam may idea kana ano isasagot. Tapos dpat familiarize mo mga connectors (like moreover, therefore, for instance, etc) kasi mas mataas ang grade kapag medyo complex ang sentence na ginagamit mo kesa simple sentences lang.

    For summarize written text strategy ko is to first get ano main topic. Then analyze what important points were given, may nangyari ba? If meron ano ang nangyari, kelan nangyari? ano at para kanino ang purpose? Usually kasi sa mga paragraphs naka detail lang pero yung point lang naman dun is parang dinedescribe lang yung main topic. If you can answer who/what, when, how and why about the topic pwede mo na pagdugtungin yung ideas mo thru connectors and form a sentence. If you will have multiple paragraphs, summarize mo muna per paragraph then summarize mo ulit lahat in one sentence

    Another tip also in writing as much as possible do not repeat the same words. If you dont have much stored knowledge about synonyms okay lang. Practice and Research is the key. Kaya malaki ang help sa akin yung pag research sa mga common or recent topics kasi while practicing pwede akong mghanap ng synonyms then mas madali ko syang ma recall sa actual exam kasi nagawa ko na sya before. Tapos if meron kayong word na ma encounter na parang hirap kayo mag elaborate, google nyo din anong synonym or phrases na pwedeng same meaning ng word. Share ko yung nilista kong mga synonyms na possible na magagamit sa mga essay kasi minsan these are the topics commonly asked.

    Essay synonyms

    Discuss- cite, mention, illustrate, narrate, elucidate, talk about

    Finally.. Concluded, In Summary

    Democracy- representative govt; elective govt; republic; commonwealth

    Vote- suffrage, ballot, poll, elect officials, select leaders, appoint, designate

    Leaders- officials, officer, commander, chief, head, principal of nations, pioneer, front runner

    Nature- mother earth, environment, wildlife, universe, cosmos, countryside, natural resources, natural world

    Environment- habitat, territory, domain, surroundings

    Teachers- educator, tutor, coach,guide, mentor, guru, professor, trainer, lecturer

    Computer- PC, laptop, netbook,desktop, terminal, mainframe

    Robot- automated individual, android, automaton, golem, bot, droid,

    Invention- creation, innovation, development, design

    Creative ability- inventive mind, originality, imagination, inspiration

    Airplane- plane, airliner, jet, plane

    Drugs- medicine, medication, remedy, cure, antidote

    Issue- matter, affairs, problem, difficulty, obstacle, predicament

    Information- details, particulars, facts, data, computing /computer

    Revolution- insurgence, transformation, innovation, revolt, uprising, restructuring

    Packaging- case, wrap

    Region, province, rural area, district, territory, district, area

    Boon- blessing, benefit, advantage

    Tourist- traveler, vacationer, visitor

    Tourism- visits to places of interest; commercial organization and operation of vacations; traveling to places; services provided to people for holidays

    Technology- invention, engineering, applied science, method, technical knowledge, undustrial science, mechanization

    Xenophobic- anti nationalist

  • bookwormbookworm Canberra
    Posts: 588Member
    Joined: Nov 27, 2013
    @chococrinkle How's your application process?

    20110812 - Submitted Vetassess docs
    20120403 - Received positive assessment
    20130622 - Took the IELTS exam (L:8, R:7, W:8.5, S:8.5, OBS:8)
    20131008 - Created and submitted EOI account
    20131216 - Started gathering documents for ACT SS
    20140113 - Submitted ACT SS nomination
    20140227 - assigned a case officer :)
    20140317 - Finally got my ACT sponsorship!
    20140319 - Invited to apply (visa 190)
    20140325 - Lodged visa 190
    20140718 - Direct visa grant. IED: July 17, 2015
    20150203 - Landed in ACT :) Job hunt begins
    201510 - Started working at Woolies
    20161031 - landed a job in my field as a junior
    20180508 - landed a job in my field

    Thank you God! You are truly amazing!

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

pumpupkiksauitdreamerBudsstkildaCarlosCzarengrdkGeorgeLeeHezronrecardopinoisaudiboi8988iblessycardo suberiekxiaoluCORTESJAYJLEvaristonayabrayajpearlthefishthekneelawelynneislovelaurenceoliveralba
Browse Members

Members Online (0) + Guest (152)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌