Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

General Skilled Immigration Visa - Step By Step Process

1148149151153154475

Comments

  • mav14mav14 Sydney
    Posts: 122Member
    Joined: May 09, 2016
    Hi guys,

    I've been a lurker here since March of this year (after our vacation in AU). After getting a glimpse of what AU has to offer (and some convincing from friends), my wife and I decided to migrate to Australia. I browsed the threads in this forum to get some tips. I didn't know about PTE (which helped in our application) until I read about it in this forum. We were also able to have the medicals early on (by My Health Declaration). Though I didn't post at that time, I got valuable information just by reading the threads.

    I was supposed to include my application in the April 2016 Visa Tracker thread since we lodged our Visa application last April 29. To our surprise, we got the grant this afternoon. We were so ecstatic to receive the golden email from GSM Adelaide!

    I'd like to give back in any way I can to this forum. Ang daming natulong sa amin ng forum na 'to!

    261311 Analyst Programmer - Main applicant (me)
    261111 ICT Business Analyst - Dependent (wife)

    31-Mar-2016: IELTS Speaking
    02-Apr-2016: IELTS (LRW)
    04-Apr-2016: ACS Assessment
    08-Apr-2016: ACS Result 7+ years credited (wife)
    11-Apr-2016: ACS Result 10+ years credited (mine)
    15-Apr-2016: IELTS Result (L/R/S/W 7.5/8.0/7.0/6.5) - I needed to reach Proficient level to get +10pts
    15-Apr-2016: IELTS Result (wife got Proficient level)
    18-Apr-2016: PTE-A
    19-Apr-2016: PTE-A Result (L/R/S/W 72/90/90/69) - I finally reached Proficient level
    19-Apr-2016: Lodged EOI (70pts)
    25-Apr-2016: Medical at St. Lukes & NBI Clearance
    27-Apr-2016: Received ITA
    29-Apr-2016: Health Clearance Provided - no action required
    29-Apr-2016: Lodged 189 Visa (Uploaded all recommended docs - No Form 80)
    09-May-2016: Direct Grant!
    10-Sep-2016: Big Move - Sydney!

  • Captain_ACaptain_A AUSTRALIA
    Posts: 2,179Member, Moderator
    Joined: Jul 04, 2012
    @mav14 congrats.. btw sale ang jetstar ngayun.. sg to oz

    18 Mar '16 IELTS Results
    06 Apr '16 EA CDR Skills Assessment submitted
    26 Apr '16 EA Skills Assessment Positive Outcome
    06 May '16 PTE-A Exam
    07 May '16 PTE- A Results & Submitted EOI
    11 May '16 Got ITA
    02 Jun '16 Lodge Visa
    04 Jul '16 Direct Grant

    Believe you can... and you're halfway there.... - Roosevelt

  • Gabrielle28Gabrielle28 Quezon City
    Posts: 60Member
    Joined: May 09, 2016
  • Gabrielle28Gabrielle28 Quezon City
    Posts: 60Member
    Joined: May 09, 2016
    Hi Po, newbie here, may i inquire if anybody can share a template for CDR? for assessment for Engineers Australia?

    Thank you.
  • se29mse29m Perth
    Posts: 2,144Member, Moderator
    Joined: Sep 14, 2015
    @mav14 congrats!

    233211 Civil Engineer
    30/09/15 - VETASSESS Lodged - 133112 Project Builder
    09/10/15 - IELTS Results: L-7.5, R-7.0, W-6.0, S-7.5 OBS-7.0
    19/10/15 - PTE A Results: L-82, R-74, S-90, W-76 OAS-79
    26/11/15 - Obtained NBI Clearance
    09/12/15 - VETASSESS Results - NEGATIVE!!!
    12/01/16 - Submitted CDR to Engineers Australia
    22/01/16 - EA Positive Results - Bachelor's Degree with 4 years 8 months skilled employment
    22/01/16 - Lodged EOI 189 (60pts)
    03/02/16 - Received 189 ITA
    11/02/16 - Health Clearance Provided - No Action Required
    18/02/16 - Obtained SG CoC
    26/02/16 - Lodged 189 Visa
    15/03/16 - Direct Grant - IED 11/02/2017
    25/05/16 - Big Move Perth!
    16/06/16 - Started Casual Work
    11/07/16 - Permanent Full-time Work

    Now for the Citizenship Journey

    26/08/2019 - Applied and acknowledgement letter received
    27/09/2019 - Test Email Invite for 19/12/2019
    01/10/2019 - Actual Test/Interview Date
    01/10/2019 - Approval Date (received the approval letter from the post 11/10/2019)
    05/02/2020 - Ceremony Date (received the email 10/01/2020)

  • Captain_ACaptain_A AUSTRALIA
    Posts: 2,179Member, Moderator
    Joined: Jul 04, 2012
    @Gabrielle28 email mo?

    18 Mar '16 IELTS Results
    06 Apr '16 EA CDR Skills Assessment submitted
    26 Apr '16 EA Skills Assessment Positive Outcome
    06 May '16 PTE-A Exam
    07 May '16 PTE- A Results & Submitted EOI
    11 May '16 Got ITA
    02 Jun '16 Lodge Visa
    04 Jul '16 Direct Grant

    Believe you can... and you're halfway there.... - Roosevelt

  • mav14mav14 Sydney
    Posts: 122Member
    Joined: May 09, 2016
    Salamat @Captain_A @se29m

    261311 Analyst Programmer - Main applicant (me)
    261111 ICT Business Analyst - Dependent (wife)

    31-Mar-2016: IELTS Speaking
    02-Apr-2016: IELTS (LRW)
    04-Apr-2016: ACS Assessment
    08-Apr-2016: ACS Result 7+ years credited (wife)
    11-Apr-2016: ACS Result 10+ years credited (mine)
    15-Apr-2016: IELTS Result (L/R/S/W 7.5/8.0/7.0/6.5) - I needed to reach Proficient level to get +10pts
    15-Apr-2016: IELTS Result (wife got Proficient level)
    18-Apr-2016: PTE-A
    19-Apr-2016: PTE-A Result (L/R/S/W 72/90/90/69) - I finally reached Proficient level
    19-Apr-2016: Lodged EOI (70pts)
    25-Apr-2016: Medical at St. Lukes & NBI Clearance
    27-Apr-2016: Received ITA
    29-Apr-2016: Health Clearance Provided - no action required
    29-Apr-2016: Lodged 189 Visa (Uploaded all recommended docs - No Form 80)
    09-May-2016: Direct Grant!
    10-Sep-2016: Big Move - Sydney!

  • tangentphtangentph Sydney, Australia
    Posts: 107Member
    Joined: May 01, 2016
    @tangentph
    1 yes
    2 yes
    3 your visa will expire, if you need to leave and re enter australia, you need to be on a valid visa again, in this case a resident return visa is applicable
    @se29m, sa SC190, kelangan maka 2 years ka ng works sa nominated state mo or 2 years hindi ka pwedeng magwork lang sa ibang state? kasi for instance pumasok ka sa state na un ng 01/2016 and nagka work ka ng 03/2016, pwede ka na magwork sa ibang state ng 02/2018 or sa 04/2018?

    ***** Student Visa 573 (SVP) *****

    Jan. 10, 2016 - IELTS Dubai Booking
    Jan. 11, 2016 - Set Appointment to IDP-Dubai (Got Discouraged)
    Jan. 23, 2016 - IELTS Test
    Feb. 06, 2016 - IELTS Results (OBS 7.5)
    Feb. 11, 2016 - IDP-Manila Counseling via Skype

    Feb. 12, 2016 - Sent via DHL Original Docs. for Univ. Application
    Feb. 12, 2016 - Sent Univ. Application (UoM, RMIT, UTS) via e-mail
    Feb. 23, 2016 - Paid UTS Application Fee AUD50 (RMIT waived) via Online Portal
    Feb. 24, 2016 - Received Application Confirmation from UoM, RMIT and UTS
    Feb. 24, 2016 - Paid UoM Application Fee AUD100

    Mar. 23, 2016 - Received Offer Letter from UTS
    Apr. 04, 2016 - Accepted UTS Offer
    Apr. 04, 2016 - Paid Tuition via peerTransfer (Take 1)
    Apr. 14, 2016 - Amount Returned Due to Wrong Currency
    Apr. 17, 2016 - Paid Tuition via peerTransfer (Take 2)
    Apr. 19, 2016 - Sent via DHL Original Docs. for Visa Application
    Apr. 20, 2016 - peerTransfer Received Payment from Bank
    Apr. 20, 2016 - peerTransfer Delivered Payment to UTS
    Apr. 26, 2016 - Received eCoE from UTS

    Apr. 27, 2016 - Visa Application Lodged by IDP
    Apr. 27, 2016 - Application Received by Aus. Embassy in Manila (Email Notification on May 3, 2016)
    May 06, 2016 - Received Offer Letter from RMIT
    May 24, 2016 - Visa Application Transferred to Australian Consulate General in Dubai
    Jun. 01, 2016 - Received Email Confirming Visa Grant (Grant Date May 29, 2016)
    Jun. 07, 2016 - Received Offer Letter from UoM

    Jul. 01, 2016 - Departure from Dubai to Phils.
    Jul. 23, 2016 - Arrival to Australia
    Jul. 25, 2016 - UTS Orientation Day
    Aug. 01, 2016 - Classes Start

    ***** Subclass Visa 189 (Civil Engineer - Planning Engineer) *****
    May 01, 2016 - Started Back Reading Here and Studying the Visa Application Process
    May 15, 2016 - Started Drafting CDR for EA Assessment
    May 23, 2016 - Submitted EA Application Online (Fast Track)
    Jun. 07, 2016 - Followed-up to EA Application Status as More than 10 Working Days Already
    Jun. 07, 2016 - Received E-mail Informing of Fast Track Fee Refund
    Jun. 07, 2016 - EA Assessment Outcome (Bachelor's Degree + All Work Experience Credited)
    Jun. 07, 2016 - Submitted EOI (70 Points)
    Jun. 07, 2016 - Received Invitation to Apply for Visa
    Jun. 17, 2016 - Received Refund from EA for Fast Track Fee
    Jul. 28, 2016 - Lodged Visa Application (189)
    Aug. 08, 2016 - Received E-mail from CO Requesting Additional Information (Saudi PCC)
    Aug. 20, 2016 - E-mail Back CO with the Additional Requirements
    Aug. 29, 2016 - Received Visa Grant!

  • CasseyCassey Melbourne, Australia
    Posts: 2,812Member, Moderator
    Joined: Sep 07, 2015
    @mav14 That was quick! Congrats! :) Welcome to Australia!

    June 16, 2013 Arrival in Melbourne (AGED CARE)
    Nov 12, 2014 Changed Visa Subclass (572->573) and Course
    Nov 13, 2014 573 Visa Approved
    Mar 2015 Nursing Conversion Course (Deakin Uni) started
    April 13, 2016 Lodged EOI thru Skill Select
    April 27, 2016 Received invitation to apply for Visa 189 (Nurse)
    May 2, 2016 Lodged application for 189 Visa (Onshore)
    May 11, 2016 CO contacted for Form 80/Medicals of daughter
    June 17, 2016 189 VISA GRANTED Thank you my amazing God :)

    Dec14, 2017 Citizenship application
    March 21, 2019 Citizenship Ceremony :)

    "Happy is the person who learns to wait as he prays and never loses his patience, for God's time is the best time."

  • mav14mav14 Sydney
    Posts: 122Member
    Joined: May 09, 2016
    Thanks @Cassey Goodluck on your visa application. Hopefully ma-grant din kayo agad :)

    261311 Analyst Programmer - Main applicant (me)
    261111 ICT Business Analyst - Dependent (wife)

    31-Mar-2016: IELTS Speaking
    02-Apr-2016: IELTS (LRW)
    04-Apr-2016: ACS Assessment
    08-Apr-2016: ACS Result 7+ years credited (wife)
    11-Apr-2016: ACS Result 10+ years credited (mine)
    15-Apr-2016: IELTS Result (L/R/S/W 7.5/8.0/7.0/6.5) - I needed to reach Proficient level to get +10pts
    15-Apr-2016: IELTS Result (wife got Proficient level)
    18-Apr-2016: PTE-A
    19-Apr-2016: PTE-A Result (L/R/S/W 72/90/90/69) - I finally reached Proficient level
    19-Apr-2016: Lodged EOI (70pts)
    25-Apr-2016: Medical at St. Lukes & NBI Clearance
    27-Apr-2016: Received ITA
    29-Apr-2016: Health Clearance Provided - no action required
    29-Apr-2016: Lodged 189 Visa (Uploaded all recommended docs - No Form 80)
    09-May-2016: Direct Grant!
    10-Sep-2016: Big Move - Sydney!

  • CasseyCassey Melbourne, Australia
    Posts: 2,812Member, Moderator
    Joined: Sep 07, 2015
    @mav14 Thank you. Hopefully, by the Grace of God. :)

    June 16, 2013 Arrival in Melbourne (AGED CARE)
    Nov 12, 2014 Changed Visa Subclass (572->573) and Course
    Nov 13, 2014 573 Visa Approved
    Mar 2015 Nursing Conversion Course (Deakin Uni) started
    April 13, 2016 Lodged EOI thru Skill Select
    April 27, 2016 Received invitation to apply for Visa 189 (Nurse)
    May 2, 2016 Lodged application for 189 Visa (Onshore)
    May 11, 2016 CO contacted for Form 80/Medicals of daughter
    June 17, 2016 189 VISA GRANTED Thank you my amazing God :)

    Dec14, 2017 Citizenship application
    March 21, 2019 Citizenship Ceremony :)

    "Happy is the person who learns to wait as he prays and never loses his patience, for God's time is the best time."

  • CasseyCassey Melbourne, Australia
    Posts: 2,812Member, Moderator
    Joined: Sep 07, 2015
    @tangentph Are you on student visa at the moment? When are you planning to apply for 189?

    June 16, 2013 Arrival in Melbourne (AGED CARE)
    Nov 12, 2014 Changed Visa Subclass (572->573) and Course
    Nov 13, 2014 573 Visa Approved
    Mar 2015 Nursing Conversion Course (Deakin Uni) started
    April 13, 2016 Lodged EOI thru Skill Select
    April 27, 2016 Received invitation to apply for Visa 189 (Nurse)
    May 2, 2016 Lodged application for 189 Visa (Onshore)
    May 11, 2016 CO contacted for Form 80/Medicals of daughter
    June 17, 2016 189 VISA GRANTED Thank you my amazing God :)

    Dec14, 2017 Citizenship application
    March 21, 2019 Citizenship Ceremony :)

    "Happy is the person who learns to wait as he prays and never loses his patience, for God's time is the best time."

  • tangentphtangentph Sydney, Australia
    Posts: 107Member
    Joined: May 01, 2016
    @Cassey Not yet. Still waiting for the grant. SVP573 applied ako. Thinking of applying for 189 after the grant kasi qualified naman ako and less pa sa tuition fee.

    ***** Student Visa 573 (SVP) *****

    Jan. 10, 2016 - IELTS Dubai Booking
    Jan. 11, 2016 - Set Appointment to IDP-Dubai (Got Discouraged)
    Jan. 23, 2016 - IELTS Test
    Feb. 06, 2016 - IELTS Results (OBS 7.5)
    Feb. 11, 2016 - IDP-Manila Counseling via Skype

    Feb. 12, 2016 - Sent via DHL Original Docs. for Univ. Application
    Feb. 12, 2016 - Sent Univ. Application (UoM, RMIT, UTS) via e-mail
    Feb. 23, 2016 - Paid UTS Application Fee AUD50 (RMIT waived) via Online Portal
    Feb. 24, 2016 - Received Application Confirmation from UoM, RMIT and UTS
    Feb. 24, 2016 - Paid UoM Application Fee AUD100

    Mar. 23, 2016 - Received Offer Letter from UTS
    Apr. 04, 2016 - Accepted UTS Offer
    Apr. 04, 2016 - Paid Tuition via peerTransfer (Take 1)
    Apr. 14, 2016 - Amount Returned Due to Wrong Currency
    Apr. 17, 2016 - Paid Tuition via peerTransfer (Take 2)
    Apr. 19, 2016 - Sent via DHL Original Docs. for Visa Application
    Apr. 20, 2016 - peerTransfer Received Payment from Bank
    Apr. 20, 2016 - peerTransfer Delivered Payment to UTS
    Apr. 26, 2016 - Received eCoE from UTS

    Apr. 27, 2016 - Visa Application Lodged by IDP
    Apr. 27, 2016 - Application Received by Aus. Embassy in Manila (Email Notification on May 3, 2016)
    May 06, 2016 - Received Offer Letter from RMIT
    May 24, 2016 - Visa Application Transferred to Australian Consulate General in Dubai
    Jun. 01, 2016 - Received Email Confirming Visa Grant (Grant Date May 29, 2016)
    Jun. 07, 2016 - Received Offer Letter from UoM

    Jul. 01, 2016 - Departure from Dubai to Phils.
    Jul. 23, 2016 - Arrival to Australia
    Jul. 25, 2016 - UTS Orientation Day
    Aug. 01, 2016 - Classes Start

    ***** Subclass Visa 189 (Civil Engineer - Planning Engineer) *****
    May 01, 2016 - Started Back Reading Here and Studying the Visa Application Process
    May 15, 2016 - Started Drafting CDR for EA Assessment
    May 23, 2016 - Submitted EA Application Online (Fast Track)
    Jun. 07, 2016 - Followed-up to EA Application Status as More than 10 Working Days Already
    Jun. 07, 2016 - Received E-mail Informing of Fast Track Fee Refund
    Jun. 07, 2016 - EA Assessment Outcome (Bachelor's Degree + All Work Experience Credited)
    Jun. 07, 2016 - Submitted EOI (70 Points)
    Jun. 07, 2016 - Received Invitation to Apply for Visa
    Jun. 17, 2016 - Received Refund from EA for Fast Track Fee
    Jul. 28, 2016 - Lodged Visa Application (189)
    Aug. 08, 2016 - Received E-mail from CO Requesting Additional Information (Saudi PCC)
    Aug. 20, 2016 - E-mail Back CO with the Additional Requirements
    Aug. 29, 2016 - Received Visa Grant!

  • CasseyCassey Melbourne, Australia
    Posts: 2,812Member, Moderator
    Joined: Sep 07, 2015
    @tangentph Oh i see, just make sure that u won't get bridging visa E if u decide to cancel your student visa grant..

    June 16, 2013 Arrival in Melbourne (AGED CARE)
    Nov 12, 2014 Changed Visa Subclass (572->573) and Course
    Nov 13, 2014 573 Visa Approved
    Mar 2015 Nursing Conversion Course (Deakin Uni) started
    April 13, 2016 Lodged EOI thru Skill Select
    April 27, 2016 Received invitation to apply for Visa 189 (Nurse)
    May 2, 2016 Lodged application for 189 Visa (Onshore)
    May 11, 2016 CO contacted for Form 80/Medicals of daughter
    June 17, 2016 189 VISA GRANTED Thank you my amazing God :)

    Dec14, 2017 Citizenship application
    March 21, 2019 Citizenship Ceremony :)

    "Happy is the person who learns to wait as he prays and never loses his patience, for God's time is the best time."

  • tangentphtangentph Sydney, Australia
    Posts: 107Member
    Joined: May 01, 2016
    @Cassey what do you mean? is the transition from student visa to pr not that simple? can you share what you know of how usually it goes for visa change similar to my case? coz right now I have yet to research on it. still working on how to make the documents required of for 189 visa. thanks.

    ***** Student Visa 573 (SVP) *****

    Jan. 10, 2016 - IELTS Dubai Booking
    Jan. 11, 2016 - Set Appointment to IDP-Dubai (Got Discouraged)
    Jan. 23, 2016 - IELTS Test
    Feb. 06, 2016 - IELTS Results (OBS 7.5)
    Feb. 11, 2016 - IDP-Manila Counseling via Skype

    Feb. 12, 2016 - Sent via DHL Original Docs. for Univ. Application
    Feb. 12, 2016 - Sent Univ. Application (UoM, RMIT, UTS) via e-mail
    Feb. 23, 2016 - Paid UTS Application Fee AUD50 (RMIT waived) via Online Portal
    Feb. 24, 2016 - Received Application Confirmation from UoM, RMIT and UTS
    Feb. 24, 2016 - Paid UoM Application Fee AUD100

    Mar. 23, 2016 - Received Offer Letter from UTS
    Apr. 04, 2016 - Accepted UTS Offer
    Apr. 04, 2016 - Paid Tuition via peerTransfer (Take 1)
    Apr. 14, 2016 - Amount Returned Due to Wrong Currency
    Apr. 17, 2016 - Paid Tuition via peerTransfer (Take 2)
    Apr. 19, 2016 - Sent via DHL Original Docs. for Visa Application
    Apr. 20, 2016 - peerTransfer Received Payment from Bank
    Apr. 20, 2016 - peerTransfer Delivered Payment to UTS
    Apr. 26, 2016 - Received eCoE from UTS

    Apr. 27, 2016 - Visa Application Lodged by IDP
    Apr. 27, 2016 - Application Received by Aus. Embassy in Manila (Email Notification on May 3, 2016)
    May 06, 2016 - Received Offer Letter from RMIT
    May 24, 2016 - Visa Application Transferred to Australian Consulate General in Dubai
    Jun. 01, 2016 - Received Email Confirming Visa Grant (Grant Date May 29, 2016)
    Jun. 07, 2016 - Received Offer Letter from UoM

    Jul. 01, 2016 - Departure from Dubai to Phils.
    Jul. 23, 2016 - Arrival to Australia
    Jul. 25, 2016 - UTS Orientation Day
    Aug. 01, 2016 - Classes Start

    ***** Subclass Visa 189 (Civil Engineer - Planning Engineer) *****
    May 01, 2016 - Started Back Reading Here and Studying the Visa Application Process
    May 15, 2016 - Started Drafting CDR for EA Assessment
    May 23, 2016 - Submitted EA Application Online (Fast Track)
    Jun. 07, 2016 - Followed-up to EA Application Status as More than 10 Working Days Already
    Jun. 07, 2016 - Received E-mail Informing of Fast Track Fee Refund
    Jun. 07, 2016 - EA Assessment Outcome (Bachelor's Degree + All Work Experience Credited)
    Jun. 07, 2016 - Submitted EOI (70 Points)
    Jun. 07, 2016 - Received Invitation to Apply for Visa
    Jun. 17, 2016 - Received Refund from EA for Fast Track Fee
    Jul. 28, 2016 - Lodged Visa Application (189)
    Aug. 08, 2016 - Received E-mail from CO Requesting Additional Information (Saudi PCC)
    Aug. 20, 2016 - E-mail Back CO with the Additional Requirements
    Aug. 29, 2016 - Received Visa Grant!

  • CasseyCassey Melbourne, Australia
    Posts: 2,812Member, Moderator
    Joined: Sep 07, 2015
    @tangentph I'll share with you our recent experience with the transition from student visa application to 189... We thought its gonna be simple but its full of technicalities.. We're onshore by the way. Before our visa expired, we decided to apply for another student visa and was given the bridging visa A. Unexpectedly, while waiting for the student visa grant we received the invite for 189. We immediately lodged our 189. So our dilemma started here, we did not get a bridging visa for the 189 right away. Turns out, that its not automatically given.. During this time, we didn't know if its safe to withdraw our student visa application or not.. So we called immi (queued for like 2 hours) and the staff told us that its better not to withdraw it just yet but wait for the BVC to be granted. During this time, we were hoping that the student visa will not be granted as it might further aggravate the situation. If it gets granted it only means that we'll need to have it cancelled and cancellation would mean that it will cancel all the bridging visas that were granted and the possibility of being unlawful as well (worst condition to be in while waiting for a PR grant,hehe). After a few days of waitin, we got the BVC. The BVC was not in effect because of the BVA that is currently in effect. We didn't know what to do, whether to withdraw our student visa application or not, and if we withdraw what are the consequences awaiting for us. I read forums and somehow freaked out a little bit because I saw a lot of applicants who are in the same situation being granted with BVE (lowest form of bridging visa-no travel rights, no work rights plus the time stayed here in Au is reset) We even asked a MARA Agent but she couldn't give us an answer.. So, i was thinking there might be a deciding factor why they got BVE, turns out they voluntarily cancelled their student visa. We called immi again and they told us that we can now safely withdraw the student visa application and the BVC will take effect after the cool down period. So fortunately, it ended well..

    Disclaimer: I'm not saying that we'll have the same situation but before you do anything call the immi first and stay away from BVE,hehe

    AND MOST IMPORTANTLY in all the things that you do whatever situation you're in just KEEP THE FAITH.
    d3ricktt

    June 16, 2013 Arrival in Melbourne (AGED CARE)
    Nov 12, 2014 Changed Visa Subclass (572->573) and Course
    Nov 13, 2014 573 Visa Approved
    Mar 2015 Nursing Conversion Course (Deakin Uni) started
    April 13, 2016 Lodged EOI thru Skill Select
    April 27, 2016 Received invitation to apply for Visa 189 (Nurse)
    May 2, 2016 Lodged application for 189 Visa (Onshore)
    May 11, 2016 CO contacted for Form 80/Medicals of daughter
    June 17, 2016 189 VISA GRANTED Thank you my amazing God :)

    Dec14, 2017 Citizenship application
    March 21, 2019 Citizenship Ceremony :)

    "Happy is the person who learns to wait as he prays and never loses his patience, for God's time is the best time."

  • tangentphtangentph Sydney, Australia
    Posts: 107Member
    Joined: May 01, 2016
    Hi @Cassey! Thanks for the heads up! Keep mind of it. Based from little I know of, I think your situation before has mainly something to do with the Australian requirement that you can only 1 visa at a time.

    You have applied for student visa that is why you will have BVA. And when you applied for 189, you cannot be issued with another bridging visa for the transition from student visa to PR visa because you have existing bridging visa already (transition for student to new student visa). You cannot cancel BVA because you will technically have no visa and you are in foreign domain.

    I am thinking if the same situation goes on to me, I will wait for my new student visa to be approved, then, logde the 189 visa (automatic issuance of bridging visa from stud. visa to pr visa). Not sure though. This is just my opinion on the grounds that you cannot have 2 visas at a time and that different bridging visa have different transition conditions (i.e., BVA for stud to stud, BVC(?) for stud to pr).

    ***** Student Visa 573 (SVP) *****

    Jan. 10, 2016 - IELTS Dubai Booking
    Jan. 11, 2016 - Set Appointment to IDP-Dubai (Got Discouraged)
    Jan. 23, 2016 - IELTS Test
    Feb. 06, 2016 - IELTS Results (OBS 7.5)
    Feb. 11, 2016 - IDP-Manila Counseling via Skype

    Feb. 12, 2016 - Sent via DHL Original Docs. for Univ. Application
    Feb. 12, 2016 - Sent Univ. Application (UoM, RMIT, UTS) via e-mail
    Feb. 23, 2016 - Paid UTS Application Fee AUD50 (RMIT waived) via Online Portal
    Feb. 24, 2016 - Received Application Confirmation from UoM, RMIT and UTS
    Feb. 24, 2016 - Paid UoM Application Fee AUD100

    Mar. 23, 2016 - Received Offer Letter from UTS
    Apr. 04, 2016 - Accepted UTS Offer
    Apr. 04, 2016 - Paid Tuition via peerTransfer (Take 1)
    Apr. 14, 2016 - Amount Returned Due to Wrong Currency
    Apr. 17, 2016 - Paid Tuition via peerTransfer (Take 2)
    Apr. 19, 2016 - Sent via DHL Original Docs. for Visa Application
    Apr. 20, 2016 - peerTransfer Received Payment from Bank
    Apr. 20, 2016 - peerTransfer Delivered Payment to UTS
    Apr. 26, 2016 - Received eCoE from UTS

    Apr. 27, 2016 - Visa Application Lodged by IDP
    Apr. 27, 2016 - Application Received by Aus. Embassy in Manila (Email Notification on May 3, 2016)
    May 06, 2016 - Received Offer Letter from RMIT
    May 24, 2016 - Visa Application Transferred to Australian Consulate General in Dubai
    Jun. 01, 2016 - Received Email Confirming Visa Grant (Grant Date May 29, 2016)
    Jun. 07, 2016 - Received Offer Letter from UoM

    Jul. 01, 2016 - Departure from Dubai to Phils.
    Jul. 23, 2016 - Arrival to Australia
    Jul. 25, 2016 - UTS Orientation Day
    Aug. 01, 2016 - Classes Start

    ***** Subclass Visa 189 (Civil Engineer - Planning Engineer) *****
    May 01, 2016 - Started Back Reading Here and Studying the Visa Application Process
    May 15, 2016 - Started Drafting CDR for EA Assessment
    May 23, 2016 - Submitted EA Application Online (Fast Track)
    Jun. 07, 2016 - Followed-up to EA Application Status as More than 10 Working Days Already
    Jun. 07, 2016 - Received E-mail Informing of Fast Track Fee Refund
    Jun. 07, 2016 - EA Assessment Outcome (Bachelor's Degree + All Work Experience Credited)
    Jun. 07, 2016 - Submitted EOI (70 Points)
    Jun. 07, 2016 - Received Invitation to Apply for Visa
    Jun. 17, 2016 - Received Refund from EA for Fast Track Fee
    Jul. 28, 2016 - Lodged Visa Application (189)
    Aug. 08, 2016 - Received E-mail from CO Requesting Additional Information (Saudi PCC)
    Aug. 20, 2016 - E-mail Back CO with the Additional Requirements
    Aug. 29, 2016 - Received Visa Grant!

  • CasseyCassey Melbourne, Australia
    Posts: 2,812Member, Moderator
    Joined: Sep 07, 2015
    @tangentph If you're planning to voluntarily cancel your student visa grant it might render you unlawful since ikacancel mo yung substantive visa to stay here in AU. That's what i understand. So be careful in cancelling your would-be-visa. Another thing to watch out for is if you decide to cancel your visa, it would mean cancelling out the other bridging visas that you have if you'll have like yung BVC na kasama ng 189 application if ever maglalodge ka. WIthdrawal of visa is different from Cancellation.

    Yung BVC namin is just waiting to take place after our BVA expires. So thank God at tama lang yung mga naging pabara bara naming desisyon gawa ng excitement. :)

    June 16, 2013 Arrival in Melbourne (AGED CARE)
    Nov 12, 2014 Changed Visa Subclass (572->573) and Course
    Nov 13, 2014 573 Visa Approved
    Mar 2015 Nursing Conversion Course (Deakin Uni) started
    April 13, 2016 Lodged EOI thru Skill Select
    April 27, 2016 Received invitation to apply for Visa 189 (Nurse)
    May 2, 2016 Lodged application for 189 Visa (Onshore)
    May 11, 2016 CO contacted for Form 80/Medicals of daughter
    June 17, 2016 189 VISA GRANTED Thank you my amazing God :)

    Dec14, 2017 Citizenship application
    March 21, 2019 Citizenship Ceremony :)

    "Happy is the person who learns to wait as he prays and never loses his patience, for God's time is the best time."

  • tangentphtangentph Sydney, Australia
    Posts: 107Member
    Joined: May 01, 2016
    @Cassey, seems not that simple than I originally thought of. what I was thinking is when I get off to Aus, after one semester, I will lodge for 189 visa and have a bridging visa in the process. after I get my 189, I will still continue studying but my tuition fee will be less than compared to holding a student visa. Anyway, I will also research on it further.

    ***** Student Visa 573 (SVP) *****

    Jan. 10, 2016 - IELTS Dubai Booking
    Jan. 11, 2016 - Set Appointment to IDP-Dubai (Got Discouraged)
    Jan. 23, 2016 - IELTS Test
    Feb. 06, 2016 - IELTS Results (OBS 7.5)
    Feb. 11, 2016 - IDP-Manila Counseling via Skype

    Feb. 12, 2016 - Sent via DHL Original Docs. for Univ. Application
    Feb. 12, 2016 - Sent Univ. Application (UoM, RMIT, UTS) via e-mail
    Feb. 23, 2016 - Paid UTS Application Fee AUD50 (RMIT waived) via Online Portal
    Feb. 24, 2016 - Received Application Confirmation from UoM, RMIT and UTS
    Feb. 24, 2016 - Paid UoM Application Fee AUD100

    Mar. 23, 2016 - Received Offer Letter from UTS
    Apr. 04, 2016 - Accepted UTS Offer
    Apr. 04, 2016 - Paid Tuition via peerTransfer (Take 1)
    Apr. 14, 2016 - Amount Returned Due to Wrong Currency
    Apr. 17, 2016 - Paid Tuition via peerTransfer (Take 2)
    Apr. 19, 2016 - Sent via DHL Original Docs. for Visa Application
    Apr. 20, 2016 - peerTransfer Received Payment from Bank
    Apr. 20, 2016 - peerTransfer Delivered Payment to UTS
    Apr. 26, 2016 - Received eCoE from UTS

    Apr. 27, 2016 - Visa Application Lodged by IDP
    Apr. 27, 2016 - Application Received by Aus. Embassy in Manila (Email Notification on May 3, 2016)
    May 06, 2016 - Received Offer Letter from RMIT
    May 24, 2016 - Visa Application Transferred to Australian Consulate General in Dubai
    Jun. 01, 2016 - Received Email Confirming Visa Grant (Grant Date May 29, 2016)
    Jun. 07, 2016 - Received Offer Letter from UoM

    Jul. 01, 2016 - Departure from Dubai to Phils.
    Jul. 23, 2016 - Arrival to Australia
    Jul. 25, 2016 - UTS Orientation Day
    Aug. 01, 2016 - Classes Start

    ***** Subclass Visa 189 (Civil Engineer - Planning Engineer) *****
    May 01, 2016 - Started Back Reading Here and Studying the Visa Application Process
    May 15, 2016 - Started Drafting CDR for EA Assessment
    May 23, 2016 - Submitted EA Application Online (Fast Track)
    Jun. 07, 2016 - Followed-up to EA Application Status as More than 10 Working Days Already
    Jun. 07, 2016 - Received E-mail Informing of Fast Track Fee Refund
    Jun. 07, 2016 - EA Assessment Outcome (Bachelor's Degree + All Work Experience Credited)
    Jun. 07, 2016 - Submitted EOI (70 Points)
    Jun. 07, 2016 - Received Invitation to Apply for Visa
    Jun. 17, 2016 - Received Refund from EA for Fast Track Fee
    Jul. 28, 2016 - Lodged Visa Application (189)
    Aug. 08, 2016 - Received E-mail from CO Requesting Additional Information (Saudi PCC)
    Aug. 20, 2016 - E-mail Back CO with the Additional Requirements
    Aug. 29, 2016 - Received Visa Grant!

  • CasseyCassey Melbourne, Australia
    Posts: 2,812Member, Moderator
    Joined: Sep 07, 2015
    @tangentph Not that simple, especially if you're planning on cancelling your student visa.. Just be careful not to be unlawful as it might affect your 189 application or if not you might get a BVE which doesn't have any work rights which may be hard not unless you have the money to sustain yourself here in Au. :) All the best!

    June 16, 2013 Arrival in Melbourne (AGED CARE)
    Nov 12, 2014 Changed Visa Subclass (572->573) and Course
    Nov 13, 2014 573 Visa Approved
    Mar 2015 Nursing Conversion Course (Deakin Uni) started
    April 13, 2016 Lodged EOI thru Skill Select
    April 27, 2016 Received invitation to apply for Visa 189 (Nurse)
    May 2, 2016 Lodged application for 189 Visa (Onshore)
    May 11, 2016 CO contacted for Form 80/Medicals of daughter
    June 17, 2016 189 VISA GRANTED Thank you my amazing God :)

    Dec14, 2017 Citizenship application
    March 21, 2019 Citizenship Ceremony :)

    "Happy is the person who learns to wait as he prays and never loses his patience, for God's time is the best time."

  • tangentphtangentph Sydney, Australia
    Posts: 107Member
    Joined: May 01, 2016
    @Cassey napaisip ako doon ah. I am searching online for similar cases but can hardly find one. I ended up making inquiry to DIBP fb page. Awaiting the response.

    ***** Student Visa 573 (SVP) *****

    Jan. 10, 2016 - IELTS Dubai Booking
    Jan. 11, 2016 - Set Appointment to IDP-Dubai (Got Discouraged)
    Jan. 23, 2016 - IELTS Test
    Feb. 06, 2016 - IELTS Results (OBS 7.5)
    Feb. 11, 2016 - IDP-Manila Counseling via Skype

    Feb. 12, 2016 - Sent via DHL Original Docs. for Univ. Application
    Feb. 12, 2016 - Sent Univ. Application (UoM, RMIT, UTS) via e-mail
    Feb. 23, 2016 - Paid UTS Application Fee AUD50 (RMIT waived) via Online Portal
    Feb. 24, 2016 - Received Application Confirmation from UoM, RMIT and UTS
    Feb. 24, 2016 - Paid UoM Application Fee AUD100

    Mar. 23, 2016 - Received Offer Letter from UTS
    Apr. 04, 2016 - Accepted UTS Offer
    Apr. 04, 2016 - Paid Tuition via peerTransfer (Take 1)
    Apr. 14, 2016 - Amount Returned Due to Wrong Currency
    Apr. 17, 2016 - Paid Tuition via peerTransfer (Take 2)
    Apr. 19, 2016 - Sent via DHL Original Docs. for Visa Application
    Apr. 20, 2016 - peerTransfer Received Payment from Bank
    Apr. 20, 2016 - peerTransfer Delivered Payment to UTS
    Apr. 26, 2016 - Received eCoE from UTS

    Apr. 27, 2016 - Visa Application Lodged by IDP
    Apr. 27, 2016 - Application Received by Aus. Embassy in Manila (Email Notification on May 3, 2016)
    May 06, 2016 - Received Offer Letter from RMIT
    May 24, 2016 - Visa Application Transferred to Australian Consulate General in Dubai
    Jun. 01, 2016 - Received Email Confirming Visa Grant (Grant Date May 29, 2016)
    Jun. 07, 2016 - Received Offer Letter from UoM

    Jul. 01, 2016 - Departure from Dubai to Phils.
    Jul. 23, 2016 - Arrival to Australia
    Jul. 25, 2016 - UTS Orientation Day
    Aug. 01, 2016 - Classes Start

    ***** Subclass Visa 189 (Civil Engineer - Planning Engineer) *****
    May 01, 2016 - Started Back Reading Here and Studying the Visa Application Process
    May 15, 2016 - Started Drafting CDR for EA Assessment
    May 23, 2016 - Submitted EA Application Online (Fast Track)
    Jun. 07, 2016 - Followed-up to EA Application Status as More than 10 Working Days Already
    Jun. 07, 2016 - Received E-mail Informing of Fast Track Fee Refund
    Jun. 07, 2016 - EA Assessment Outcome (Bachelor's Degree + All Work Experience Credited)
    Jun. 07, 2016 - Submitted EOI (70 Points)
    Jun. 07, 2016 - Received Invitation to Apply for Visa
    Jun. 17, 2016 - Received Refund from EA for Fast Track Fee
    Jul. 28, 2016 - Lodged Visa Application (189)
    Aug. 08, 2016 - Received E-mail from CO Requesting Additional Information (Saudi PCC)
    Aug. 20, 2016 - E-mail Back CO with the Additional Requirements
    Aug. 29, 2016 - Received Visa Grant!

  • CasseyCassey Melbourne, Australia
    Posts: 2,812Member, Moderator
    Joined: Sep 07, 2015
    @tangentph try searching voluntary visa cancellation sa mga forum, maraming ganung cases. If not 189 partner visa kinukuha nila..para you'll have an insight.

    June 16, 2013 Arrival in Melbourne (AGED CARE)
    Nov 12, 2014 Changed Visa Subclass (572->573) and Course
    Nov 13, 2014 573 Visa Approved
    Mar 2015 Nursing Conversion Course (Deakin Uni) started
    April 13, 2016 Lodged EOI thru Skill Select
    April 27, 2016 Received invitation to apply for Visa 189 (Nurse)
    May 2, 2016 Lodged application for 189 Visa (Onshore)
    May 11, 2016 CO contacted for Form 80/Medicals of daughter
    June 17, 2016 189 VISA GRANTED Thank you my amazing God :)

    Dec14, 2017 Citizenship application
    March 21, 2019 Citizenship Ceremony :)

    "Happy is the person who learns to wait as he prays and never loses his patience, for God's time is the best time."

  • tangentphtangentph Sydney, Australia
    Posts: 107Member
    Joined: May 01, 2016
    @Cassey thank you very much! I will try to check out the ins and outs of it. hope I can get more information from you later on after I have researched also on my own.

    ***** Student Visa 573 (SVP) *****

    Jan. 10, 2016 - IELTS Dubai Booking
    Jan. 11, 2016 - Set Appointment to IDP-Dubai (Got Discouraged)
    Jan. 23, 2016 - IELTS Test
    Feb. 06, 2016 - IELTS Results (OBS 7.5)
    Feb. 11, 2016 - IDP-Manila Counseling via Skype

    Feb. 12, 2016 - Sent via DHL Original Docs. for Univ. Application
    Feb. 12, 2016 - Sent Univ. Application (UoM, RMIT, UTS) via e-mail
    Feb. 23, 2016 - Paid UTS Application Fee AUD50 (RMIT waived) via Online Portal
    Feb. 24, 2016 - Received Application Confirmation from UoM, RMIT and UTS
    Feb. 24, 2016 - Paid UoM Application Fee AUD100

    Mar. 23, 2016 - Received Offer Letter from UTS
    Apr. 04, 2016 - Accepted UTS Offer
    Apr. 04, 2016 - Paid Tuition via peerTransfer (Take 1)
    Apr. 14, 2016 - Amount Returned Due to Wrong Currency
    Apr. 17, 2016 - Paid Tuition via peerTransfer (Take 2)
    Apr. 19, 2016 - Sent via DHL Original Docs. for Visa Application
    Apr. 20, 2016 - peerTransfer Received Payment from Bank
    Apr. 20, 2016 - peerTransfer Delivered Payment to UTS
    Apr. 26, 2016 - Received eCoE from UTS

    Apr. 27, 2016 - Visa Application Lodged by IDP
    Apr. 27, 2016 - Application Received by Aus. Embassy in Manila (Email Notification on May 3, 2016)
    May 06, 2016 - Received Offer Letter from RMIT
    May 24, 2016 - Visa Application Transferred to Australian Consulate General in Dubai
    Jun. 01, 2016 - Received Email Confirming Visa Grant (Grant Date May 29, 2016)
    Jun. 07, 2016 - Received Offer Letter from UoM

    Jul. 01, 2016 - Departure from Dubai to Phils.
    Jul. 23, 2016 - Arrival to Australia
    Jul. 25, 2016 - UTS Orientation Day
    Aug. 01, 2016 - Classes Start

    ***** Subclass Visa 189 (Civil Engineer - Planning Engineer) *****
    May 01, 2016 - Started Back Reading Here and Studying the Visa Application Process
    May 15, 2016 - Started Drafting CDR for EA Assessment
    May 23, 2016 - Submitted EA Application Online (Fast Track)
    Jun. 07, 2016 - Followed-up to EA Application Status as More than 10 Working Days Already
    Jun. 07, 2016 - Received E-mail Informing of Fast Track Fee Refund
    Jun. 07, 2016 - EA Assessment Outcome (Bachelor's Degree + All Work Experience Credited)
    Jun. 07, 2016 - Submitted EOI (70 Points)
    Jun. 07, 2016 - Received Invitation to Apply for Visa
    Jun. 17, 2016 - Received Refund from EA for Fast Track Fee
    Jul. 28, 2016 - Lodged Visa Application (189)
    Aug. 08, 2016 - Received E-mail from CO Requesting Additional Information (Saudi PCC)
    Aug. 20, 2016 - E-mail Back CO with the Additional Requirements
    Aug. 29, 2016 - Received Visa Grant!

  • CasseyCassey Melbourne, Australia
    Posts: 2,812Member, Moderator
    Joined: Sep 07, 2015
    edited May 2016
    @tangentph No worries, i hope DIBP will not think that you're not a genuine student by asking so... Remember yung so-called na "GTE". Feel free to ask, :) It's my pleasure to help.

    June 16, 2013 Arrival in Melbourne (AGED CARE)
    Nov 12, 2014 Changed Visa Subclass (572->573) and Course
    Nov 13, 2014 573 Visa Approved
    Mar 2015 Nursing Conversion Course (Deakin Uni) started
    April 13, 2016 Lodged EOI thru Skill Select
    April 27, 2016 Received invitation to apply for Visa 189 (Nurse)
    May 2, 2016 Lodged application for 189 Visa (Onshore)
    May 11, 2016 CO contacted for Form 80/Medicals of daughter
    June 17, 2016 189 VISA GRANTED Thank you my amazing God :)

    Dec14, 2017 Citizenship application
    March 21, 2019 Citizenship Ceremony :)

    "Happy is the person who learns to wait as he prays and never loses his patience, for God's time is the best time."

  • tangentphtangentph Sydney, Australia
    Posts: 107Member
    Joined: May 01, 2016
    @Cassey that might be their perception. but i will still be studying even if i have the 189 visa. with 189 i still can study but with less tuition fee. plus, i will be turning 33 next year so if i can do it this year, then, why not. i already have 55 points even without work experience. but i have to go through the assessment first for my degree and if i can get some years for work experience, it will be a big bonus.

    ***** Student Visa 573 (SVP) *****

    Jan. 10, 2016 - IELTS Dubai Booking
    Jan. 11, 2016 - Set Appointment to IDP-Dubai (Got Discouraged)
    Jan. 23, 2016 - IELTS Test
    Feb. 06, 2016 - IELTS Results (OBS 7.5)
    Feb. 11, 2016 - IDP-Manila Counseling via Skype

    Feb. 12, 2016 - Sent via DHL Original Docs. for Univ. Application
    Feb. 12, 2016 - Sent Univ. Application (UoM, RMIT, UTS) via e-mail
    Feb. 23, 2016 - Paid UTS Application Fee AUD50 (RMIT waived) via Online Portal
    Feb. 24, 2016 - Received Application Confirmation from UoM, RMIT and UTS
    Feb. 24, 2016 - Paid UoM Application Fee AUD100

    Mar. 23, 2016 - Received Offer Letter from UTS
    Apr. 04, 2016 - Accepted UTS Offer
    Apr. 04, 2016 - Paid Tuition via peerTransfer (Take 1)
    Apr. 14, 2016 - Amount Returned Due to Wrong Currency
    Apr. 17, 2016 - Paid Tuition via peerTransfer (Take 2)
    Apr. 19, 2016 - Sent via DHL Original Docs. for Visa Application
    Apr. 20, 2016 - peerTransfer Received Payment from Bank
    Apr. 20, 2016 - peerTransfer Delivered Payment to UTS
    Apr. 26, 2016 - Received eCoE from UTS

    Apr. 27, 2016 - Visa Application Lodged by IDP
    Apr. 27, 2016 - Application Received by Aus. Embassy in Manila (Email Notification on May 3, 2016)
    May 06, 2016 - Received Offer Letter from RMIT
    May 24, 2016 - Visa Application Transferred to Australian Consulate General in Dubai
    Jun. 01, 2016 - Received Email Confirming Visa Grant (Grant Date May 29, 2016)
    Jun. 07, 2016 - Received Offer Letter from UoM

    Jul. 01, 2016 - Departure from Dubai to Phils.
    Jul. 23, 2016 - Arrival to Australia
    Jul. 25, 2016 - UTS Orientation Day
    Aug. 01, 2016 - Classes Start

    ***** Subclass Visa 189 (Civil Engineer - Planning Engineer) *****
    May 01, 2016 - Started Back Reading Here and Studying the Visa Application Process
    May 15, 2016 - Started Drafting CDR for EA Assessment
    May 23, 2016 - Submitted EA Application Online (Fast Track)
    Jun. 07, 2016 - Followed-up to EA Application Status as More than 10 Working Days Already
    Jun. 07, 2016 - Received E-mail Informing of Fast Track Fee Refund
    Jun. 07, 2016 - EA Assessment Outcome (Bachelor's Degree + All Work Experience Credited)
    Jun. 07, 2016 - Submitted EOI (70 Points)
    Jun. 07, 2016 - Received Invitation to Apply for Visa
    Jun. 17, 2016 - Received Refund from EA for Fast Track Fee
    Jul. 28, 2016 - Lodged Visa Application (189)
    Aug. 08, 2016 - Received E-mail from CO Requesting Additional Information (Saudi PCC)
    Aug. 20, 2016 - E-mail Back CO with the Additional Requirements
    Aug. 29, 2016 - Received Visa Grant!

  • sammiesamsammiesam Melbourne
    Posts: 29Member
    Joined: Aug 23, 2015
    Hi po, may question po ako. If na invite na sa SkillSelect, yung ibig sabihin b na "lodge visa" ay yung "apply visa" sa skillselect page? Tapos paano ko ba mkikita yung tinatawg na ImmiAccount? Automatic po ba yan mki-create if nag apply visa na ako?

    Thanks po sa inyo :)
  • CasseyCassey Melbourne, Australia
    Posts: 2,812Member, Moderator
    Joined: Sep 07, 2015
    @sammiesam yes, yung lodge visa means its to apply visa. Dadalhin ka nun sa immi account. Hindi automatic na makicreate yun, ikaw ang gagawa. :)

    June 16, 2013 Arrival in Melbourne (AGED CARE)
    Nov 12, 2014 Changed Visa Subclass (572->573) and Course
    Nov 13, 2014 573 Visa Approved
    Mar 2015 Nursing Conversion Course (Deakin Uni) started
    April 13, 2016 Lodged EOI thru Skill Select
    April 27, 2016 Received invitation to apply for Visa 189 (Nurse)
    May 2, 2016 Lodged application for 189 Visa (Onshore)
    May 11, 2016 CO contacted for Form 80/Medicals of daughter
    June 17, 2016 189 VISA GRANTED Thank you my amazing God :)

    Dec14, 2017 Citizenship application
    March 21, 2019 Citizenship Ceremony :)

    "Happy is the person who learns to wait as he prays and never loses his patience, for God's time is the best time."

  • sammiesamsammiesam Melbourne
    Posts: 29Member
    Joined: Aug 23, 2015
    @cassey thanks po sa response.

    Tanong po ako ulit. Nakikita ko lng sa ibang timeline dito sa forum compared sa info sa DIBP website, pwede po b pla unahin yung medical at police clearance before maglodge? If pwede po, ano po yung ipapakita sa medical at police na document/s?

    Thanks in advance :)
  • Captain_ACaptain_A AUSTRALIA
    Posts: 2,179Member, Moderator
    Joined: Jul 04, 2012
    @sammiesam im currently on that stage. pwede po sya as long as meron kana immiaccount then you can generate hap id at referral letter to do medicals. sa NBI clearance, wala nmn docs na required pwede na kumuha before lodge.. para nmn sa police clearance abroad, like s singapore, may requirement sila na doc from DIBP bago ka makakakuha, in my case referral letter, invitation letter at yung form sa immiaccount ipapakita ko para kasama name ng wife ko.

    18 Mar '16 IELTS Results
    06 Apr '16 EA CDR Skills Assessment submitted
    26 Apr '16 EA Skills Assessment Positive Outcome
    06 May '16 PTE-A Exam
    07 May '16 PTE- A Results & Submitted EOI
    11 May '16 Got ITA
    02 Jun '16 Lodge Visa
    04 Jul '16 Direct Grant

    Believe you can... and you're halfway there.... - Roosevelt

  • tangentphtangentph Sydney, Australia
    Posts: 107Member
    Joined: May 01, 2016
    @Cassey were you able to sort out your situation before? did you get the service of MARA agent? if i may, how much was the service fee for the agent?

    ***** Student Visa 573 (SVP) *****

    Jan. 10, 2016 - IELTS Dubai Booking
    Jan. 11, 2016 - Set Appointment to IDP-Dubai (Got Discouraged)
    Jan. 23, 2016 - IELTS Test
    Feb. 06, 2016 - IELTS Results (OBS 7.5)
    Feb. 11, 2016 - IDP-Manila Counseling via Skype

    Feb. 12, 2016 - Sent via DHL Original Docs. for Univ. Application
    Feb. 12, 2016 - Sent Univ. Application (UoM, RMIT, UTS) via e-mail
    Feb. 23, 2016 - Paid UTS Application Fee AUD50 (RMIT waived) via Online Portal
    Feb. 24, 2016 - Received Application Confirmation from UoM, RMIT and UTS
    Feb. 24, 2016 - Paid UoM Application Fee AUD100

    Mar. 23, 2016 - Received Offer Letter from UTS
    Apr. 04, 2016 - Accepted UTS Offer
    Apr. 04, 2016 - Paid Tuition via peerTransfer (Take 1)
    Apr. 14, 2016 - Amount Returned Due to Wrong Currency
    Apr. 17, 2016 - Paid Tuition via peerTransfer (Take 2)
    Apr. 19, 2016 - Sent via DHL Original Docs. for Visa Application
    Apr. 20, 2016 - peerTransfer Received Payment from Bank
    Apr. 20, 2016 - peerTransfer Delivered Payment to UTS
    Apr. 26, 2016 - Received eCoE from UTS

    Apr. 27, 2016 - Visa Application Lodged by IDP
    Apr. 27, 2016 - Application Received by Aus. Embassy in Manila (Email Notification on May 3, 2016)
    May 06, 2016 - Received Offer Letter from RMIT
    May 24, 2016 - Visa Application Transferred to Australian Consulate General in Dubai
    Jun. 01, 2016 - Received Email Confirming Visa Grant (Grant Date May 29, 2016)
    Jun. 07, 2016 - Received Offer Letter from UoM

    Jul. 01, 2016 - Departure from Dubai to Phils.
    Jul. 23, 2016 - Arrival to Australia
    Jul. 25, 2016 - UTS Orientation Day
    Aug. 01, 2016 - Classes Start

    ***** Subclass Visa 189 (Civil Engineer - Planning Engineer) *****
    May 01, 2016 - Started Back Reading Here and Studying the Visa Application Process
    May 15, 2016 - Started Drafting CDR for EA Assessment
    May 23, 2016 - Submitted EA Application Online (Fast Track)
    Jun. 07, 2016 - Followed-up to EA Application Status as More than 10 Working Days Already
    Jun. 07, 2016 - Received E-mail Informing of Fast Track Fee Refund
    Jun. 07, 2016 - EA Assessment Outcome (Bachelor's Degree + All Work Experience Credited)
    Jun. 07, 2016 - Submitted EOI (70 Points)
    Jun. 07, 2016 - Received Invitation to Apply for Visa
    Jun. 17, 2016 - Received Refund from EA for Fast Track Fee
    Jul. 28, 2016 - Lodged Visa Application (189)
    Aug. 08, 2016 - Received E-mail from CO Requesting Additional Information (Saudi PCC)
    Aug. 20, 2016 - E-mail Back CO with the Additional Requirements
    Aug. 29, 2016 - Received Visa Grant!

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

andreamndnslinhoucailinhoucai123AusJourneymaamafaithauwrkunomigs8Kath06surayyo19921deltaexecutorArvsmauricejanggoIvansnow4004banana24_maishaleonabob34_leepwinkytikatikarikaweesralifeafter23
Browse Members

Members Online (0) + Guest (163)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌