Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

Anyone here from Toowoomba?

graceegracee SydneyPosts: 72Member
Hello po sa inyong lahat. I recently got my visa grant 489 last Jan 8. I plan to go to Toowoomba kasi yun po nilagay ko sa commitment statement ko. But I don't know where to start kc wala naman po ako kakilala. Hope you can help me. I need to find a place to stay and a job. kahit ano lang po work basta makasimula lang. or kahit advice lang po kung ano pwede ko gawin. thank u
«1

Comments

  • MarieMarie Queensland
    Posts: 42Member
    Joined: Jul 07, 2012
    edited January 2015
    @gracee,
    Hi, when do you intend to travel to Toowoomba? Will you be by yourself or with your family? If you don't mind me asking. There is a bus service from Brisbane Int'l airport to Toowoomba, not sure how much is the current fares, paki check mo sa website ng Greyhound Australia. Toowoomba, at this time it's not so hot nor cold (raining actually), winter is coming by May so pack up some warm clothings/jackets, it will get cold.

    In every beginning talagang mahirap, but somehow u will open a new chapter in ur life, and eventually malalagpasan mo lahat ng yan. Ito na muna at the moment, hope this will get u started.
  • graceegracee Sydney
    Posts: 72Member
    Joined: Jan 19, 2015
    Hi Marie. Thank u sa pagreply. Tentatively plan ko sana sa July. Ako lang po magisa. Balak namin mag-apply sister ko ng tourist visa para po may kasama naman ako pagpunta. Baka po may masuggest kayo na place pwede namin matuluyan na mura lang hehe. Sana po yung may mga pinoy para makapagtanong ako sa kanila. Salamat
  • MarieMarie Queensland
    Posts: 42Member
    Joined: Jul 07, 2012
    @gracee, still a long way, July. Try checking this site, it's an accommodations for students, but i was told that they also accept non-student, try browsing and inquiring. It's very near the USQ-Toowoomba. In and around that area, madaming mga pinoys, I can give u their contact numbers and ours just in case, but not in here. I believe per person ang payment dito even if you're intending of going sa mga pinoys for bedspace. May mga short term accommodations (motels/hotels) but theirs is a per day rate, not recommended sa mga starting na gaya mo.

    http://www.studentvillage.com.au/

    To succeed, take a lot of courage and determination, mix in a handfuls of faith, prayer and trust, stir in with some social interactions (pakikisama) and respect, and for sure u'll overcome the hardship.
  • graceegracee Sydney
    Posts: 72Member
    Joined: Jan 19, 2015
    Marie, salamat. I will check the site. Ang hirap magsimula. All the info and words of encouragement you are giving me are really helping me a lot. Yes please I would like to ask for the contact numbers, yours too :) You can email me at email8tome@yahoo.com. Thank you.
  • MarieMarie Queensland
    Posts: 42Member
    Joined: Jul 07, 2012
    Gracee, mahirap sa simula, that's normal, everyone passes thru that, malagpasan mo lahat yan. Everybody went thru it and somehow survived. Inform me about that site I gave you so we can see what will be your next step.

    I'll tell you everything you want to know and everything there is to know about Toowoomba, so long as I can answer it. Till next time, Cheers
  • graceegracee Sydney
    Posts: 72Member
    Joined: Jan 19, 2015
    Hi Marie,

    I already inquired with the student village. Apparently, they don't accept non-students. This is their reply.

    "Thanks you for your email. You are required to be studying at the USQ or Toowoomba Tafe to live at The Student Village however thank you for your enquiry all the same."

    Can you suggest other accommodations?

    Thank you.
  • MarieMarie Queensland
    Posts: 42Member
    Joined: Jul 07, 2012
    Gracee,

    i'll be sending emails in your nominated email add anytime soon.

    be good, trust and have faith, you'll get help.

    cheers,
  • Mike24Mike24 Brisbane
    Posts: 8Member
    Joined: Feb 17, 2015
    Hi @gracee and @Marie, I already lodged my visa application for Toowoomba. I hope I could ask help from you guys if it gets approve. :) I will be going there alone just encase, which I think will be hard.
  • graceegracee Sydney
    Posts: 72Member
    Joined: Jan 19, 2015
    Hi Mike24. Actually, di pa ako umaalis kasi natatakot pa ako. Nagiipon pa ko ng lakas ng loob hehe. @Marie is offering me help but nothing is final yet. As of now we are still communicating. You are already applying for visa so that means you already have state nomination from Queensland? Let me know pag naapprove visa mo para sabay na lang tayo umalis hehe.
  • basiabasia Brisbane
    Posts: 57Member
    Joined: May 06, 2015
    ako po ay taga TOOWOOMBA!!! @gracee and @mike24
  • elainedeveraelainedevera Kensington
    Posts: 119Member
    Joined: May 06, 2015
    Hello po @gracee at @mike24!

    Meron pong website na realestate.com.au for the accommodation, di ko lang po alam kung me makikita po kayo dito. Pwede rin po kayo maghanap sa gumtree.com.au me nagaadvertise din po ng housemates dun.

    Nagpaprocess pa lang po kasi ako ng cdr sa engineers australia. Pero i have been there (wynnum and roma) from jan 2013 to oct 2014 under visa 457. Jan po kami sa realestate.com.au naghanap ng apartments.

    Mahirap po talaga sa umpisa, pero kayang kaya nyo po yan.

    God bless po!

    December 13, 2014 - IELTS (Competent)
    January 19, 2015 - Submission of CDR in EA Portal online
    May 4, 2015 - Received Shortcoming Letter (TOR)
    May 5, 2015 - Responded to Shortcoming Letter
    May 22, 2015 - Received positive EA assessment
    May 25, 2015 - Submitted EOI
    July 6, 2015 - Received Invitation Letter/immiaccount submission
    July 8, 2015 - Lodged Application for Visa
    August 22, 2015 - document upload
    September 1, 2015 - Shortcoming List from CO
    September 25, 2015 - completed shortcoming list
    November 10, 2015 - Visa 189 Grant
    May 28, 2016 - Big move (Brisbane)

  • Mike24Mike24 Brisbane
    Posts: 8Member
    Joined: Feb 17, 2015
    Hi @basia, okay din po ba ang Toowoomba? :)
  • agentKamsagentKams Toowoomba
    Posts: 861Member
    Joined: Apr 25, 2014
    hi everyone, just arrived in Toowoomba last Wednesday. Hoping to get connected with fellow Filos here. :)

    Timeline: Student Visa Subclass 573 (Masters)
    06 July 2015: Visa Grant
    April 2018: Uni Graduation

    Timeline: Permanent Visa (189) Accountant 221111
    18 April 2018: ITA received - Visa 189
    04 May 2018 : Lodged Visa Application - Visa 189
    29 Aug 2018 - First CO Contact - PCC Qatar (partner)
    9 Jan 2019 - 2nd CO Contact - penal waiver
    18 Jan 2019 - Updated immiaccount with penal waiver
    29 Jan 2019 - Forwarded PCC to gsm.allocated email
    8 Feb 2019 - Visa Grant - Finally!!

    Timeline: Citizenship
    July 2020: Application lodgment
    May 2021: Citizenship Exam
    Feb 2022: Oi! Oi! Oi! Aussie na din sa wakas!

  • agentKamsagentKams Toowoomba
    Posts: 861Member
    Joined: Apr 25, 2014
    @basia hello po, ask ko lang if you know of any part time work po. been here in a week na din. salamat po. :)

    Timeline: Student Visa Subclass 573 (Masters)
    06 July 2015: Visa Grant
    April 2018: Uni Graduation

    Timeline: Permanent Visa (189) Accountant 221111
    18 April 2018: ITA received - Visa 189
    04 May 2018 : Lodged Visa Application - Visa 189
    29 Aug 2018 - First CO Contact - PCC Qatar (partner)
    9 Jan 2019 - 2nd CO Contact - penal waiver
    18 Jan 2019 - Updated immiaccount with penal waiver
    29 Jan 2019 - Forwarded PCC to gsm.allocated email
    8 Feb 2019 - Visa Grant - Finally!!

    Timeline: Citizenship
    July 2020: Application lodgment
    May 2021: Citizenship Exam
    Feb 2022: Oi! Oi! Oi! Aussie na din sa wakas!

  • Mike24Mike24 Brisbane
    Posts: 8Member
    Joined: Feb 17, 2015
    @gycelle hi Ms Gycelle. my nominated place is also Toowoomba but im still in medical stage pa lang ng pag process ng visa. Hopefully ma approve din visa ko to go there asap. ask ko lang po..what are the pros and cons ng Toowoomba based on your experience. Thanks
  • MarieMarie Queensland
    Posts: 42Member
    Joined: Jul 07, 2012
    @gycelle,
    where r u currently residing? if u want to meet pinoys, and if u don't mind me asking, do u go to church? i u do, u can go to Sacred Heart Church, saturday or sunday mass at 5:30 and 6:00 PM, there u'll see a lot of pinoys, may salo salo pa. or u can go to Hooper Center, there is this Asian Store (J&R) pinay ang owner or bantay, talk to them.

    @Mike24,
    All pros, no cons, it depends on u
  • MarieMarie Queensland
    Posts: 42Member
    Joined: Jul 07, 2012
    @gycelle,
    St. Patrick, masses @ 7:00, 9:00 and 5:30 (Sat), 6:00 (Sun), there are some/few Pinoys unlike Sacred Heart, cause i know that 2 or 3 Filipino priests are officiating the mass, may isa pang Catholic church near newtown, Lourdes Church/School, Sunday mass may pinoy but ilan ilan lang
  • agentKamsagentKams Toowoomba
    Posts: 861Member
    Joined: Apr 25, 2014
    @gycelle hi sis, am student as well in USQ we can meet up if you want on free time. msg mo ako if. we go to Sacred Heart church every sunday 530pm. ^_^

    Timeline: Student Visa Subclass 573 (Masters)
    06 July 2015: Visa Grant
    April 2018: Uni Graduation

    Timeline: Permanent Visa (189) Accountant 221111
    18 April 2018: ITA received - Visa 189
    04 May 2018 : Lodged Visa Application - Visa 189
    29 Aug 2018 - First CO Contact - PCC Qatar (partner)
    9 Jan 2019 - 2nd CO Contact - penal waiver
    18 Jan 2019 - Updated immiaccount with penal waiver
    29 Jan 2019 - Forwarded PCC to gsm.allocated email
    8 Feb 2019 - Visa Grant - Finally!!

    Timeline: Citizenship
    July 2020: Application lodgment
    May 2021: Citizenship Exam
    Feb 2022: Oi! Oi! Oi! Aussie na din sa wakas!

  • agentKamsagentKams Toowoomba
    Posts: 861Member
    Joined: Apr 25, 2014
    @gycelle hehehe. ok neng. iyong sacred hearth sa wilsonton iyon. :)

    Timeline: Student Visa Subclass 573 (Masters)
    06 July 2015: Visa Grant
    April 2018: Uni Graduation

    Timeline: Permanent Visa (189) Accountant 221111
    18 April 2018: ITA received - Visa 189
    04 May 2018 : Lodged Visa Application - Visa 189
    29 Aug 2018 - First CO Contact - PCC Qatar (partner)
    9 Jan 2019 - 2nd CO Contact - penal waiver
    18 Jan 2019 - Updated immiaccount with penal waiver
    29 Jan 2019 - Forwarded PCC to gsm.allocated email
    8 Feb 2019 - Visa Grant - Finally!!

    Timeline: Citizenship
    July 2020: Application lodgment
    May 2021: Citizenship Exam
    Feb 2022: Oi! Oi! Oi! Aussie na din sa wakas!

  • rylynnrylynn Sydney
    Posts: 161Member
    Joined: Aug 26, 2012
    september is flower festival in toowomba.. Daming pinoy punta , isa na kami doon.
    But we are in Brisbane area so mga 1 hr++ drive.

    Nov 30, 2012 - IELTS OBS 7.0
    Dec 21,2012-EA received documents :
    May 21, 2013- Received Positive assessment (released 15 May)
    May 21,2013 - Lodged EOI -Visa 189
    June 3, 2013- Invited Visa 189
    June 4 , 2013 - Lodged Visa
    June 5,2013- Uploaded documents and certificate
    June 15, 2013 - Uploaded NBI Clearance
    June 29, 2013- DIAC received medical through SATA Bedok
    July 30,2013- CO Assigned GSM Team 33 Brisbane
    Aug 22,2013- Uploaded SG Clearance (3 weeks processing)
    Aug 23,2013- VISA GRANT (IED June 19 2014)
    March 22,2014 - Arrived in Brisbane
    May 21,2014 - Hubby started work
    July 22,2014 -started work

  • mariechellemariechelle Brisbane
    Posts: 38Member
    Joined: Jul 03, 2015
    @rylynn punta rin po kami ng partner ko sa toowoomba sa september mukhang maganda ung festival.. :) currently nagiisip kami ano sasakyan galing brisbane since wala naman train na papunta doon.. :)
  • Mike24Mike24 Brisbane
    Posts: 8Member
    Joined: Feb 17, 2015
    @Marie thats great! thanks po sa info! in God's time i will be there :)
  • Mike24Mike24 Brisbane
    Posts: 8Member
    Joined: Feb 17, 2015
    hi guys. im looking for a room to rent in toowoomba for january 2016. baka po may ma refer kayo. thanks!:)
  • Mike24Mike24 Brisbane
    Posts: 8Member
    Joined: Feb 17, 2015
    hi guys. im looking for a room to rent in toowoomba for january 2016. baka po may ma refer kayo. thanks!:) @marie @agentKams @gycelle @rylynn
  • vhoythoyvhoythoy Melbourne
    Posts: 1,550Member, Moderator
    Joined: Oct 31, 2012
    Paano nyo madedescribe and buhay sa toowoomba? Boring ba or tama lang?

    ANZSCO 221214 - Internal Auditor
    19 Jan 13 - Academic IELTS Results - passed
    12 July 13 - Vetassess Assessment + Point Test Advice: Positive
    03 Nov 13 - Invitation Accepted 70 points
    19 Dec 13 - Lodged Visa 189
    07 Feb 14 - Visa Granted
    04 Aug 14 - Initial Entry Date requirement
    26 July 14 - Actual IED to Melbourne
    May 2015 - Big Move
    June 2015 - Got a permanent role in Melbourne
    Apr 2016 - Got a contract consultancy role in Melbourne
    May 2016 - Got permanent role and moved to Toowooba, Queensland

    And now...... living the life that i have imagined

    "A great photograph is one that fully expresses what one feels, in the deepest sense, about what is being photographed" - Ansel Adams

  • agentKamsagentKams Toowoomba
    Posts: 861Member
    Joined: Apr 25, 2014
    @vhoythoy buhay probinsiya ang meron sa Toowoomba. You might find it boring pag mahilig sa nightlife or single ka. Good for family and retiree.

    Timeline: Student Visa Subclass 573 (Masters)
    06 July 2015: Visa Grant
    April 2018: Uni Graduation

    Timeline: Permanent Visa (189) Accountant 221111
    18 April 2018: ITA received - Visa 189
    04 May 2018 : Lodged Visa Application - Visa 189
    29 Aug 2018 - First CO Contact - PCC Qatar (partner)
    9 Jan 2019 - 2nd CO Contact - penal waiver
    18 Jan 2019 - Updated immiaccount with penal waiver
    29 Jan 2019 - Forwarded PCC to gsm.allocated email
    8 Feb 2019 - Visa Grant - Finally!!

    Timeline: Citizenship
    July 2020: Application lodgment
    May 2021: Citizenship Exam
    Feb 2022: Oi! Oi! Oi! Aussie na din sa wakas!

  • vhoythoyvhoythoy Melbourne
    Posts: 1,550Member, Moderator
    Joined: Oct 31, 2012
    We will move to Toowoomba by end of May. May alam ba kayong temporary accommodations na pwede namin tirhan? or through realestate.com/ domain.au lang? Saan suburb dun maganda, ung convenient going to the city. thanks

    ANZSCO 221214 - Internal Auditor
    19 Jan 13 - Academic IELTS Results - passed
    12 July 13 - Vetassess Assessment + Point Test Advice: Positive
    03 Nov 13 - Invitation Accepted 70 points
    19 Dec 13 - Lodged Visa 189
    07 Feb 14 - Visa Granted
    04 Aug 14 - Initial Entry Date requirement
    26 July 14 - Actual IED to Melbourne
    May 2015 - Big Move
    June 2015 - Got a permanent role in Melbourne
    Apr 2016 - Got a contract consultancy role in Melbourne
    May 2016 - Got permanent role and moved to Toowooba, Queensland

    And now...... living the life that i have imagined

    "A great photograph is one that fully expresses what one feels, in the deepest sense, about what is being photographed" - Ansel Adams

  • happyfaithhappyfaith philippines
    Posts: 4Member
    Joined: Jan 08, 2017
    @basia hi po, I am moving to Toowoomba on March 5. Naghahanap po ako ng room for rent or kahit bedspace lang. Sa initial entry ko, I will be with my husband and my son but they will stay 3 months max kasi tourist visa lang sila. If you can give me any heads up regarding accommodations, I appreciate it so much.
  • Cecil LitoCecil Lito Philippines
    Posts: 18Member
    Joined: Jun 04, 2017
    Hello..Magkano ba ang rent sa Toowoomba for 2 bedrooms. Doon kasi ako ma-assign kung ma-approve 457 namin. Thanks
  • Bingchiong1Bingchiong1 Mandaluyong
    Posts: 37Member
    Joined: Jul 02, 2013
    Hello!!!! Pwedeng mag ask if may kilalakayong pinoy dito sa Toowomba na pwede magbabysit nang 6 years old?salamat.
Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

hael17moonytrxmaikzxperezjecillevmalicdempayterwynpayterwyn_007kimpz0701HowardElerbjayallenb_sydneykbadmdabortizchlorineaubreygamuedacarlitooocooljudgesorianokotenlazuelaLorine
Browse Members

Members Online (0) + Guest (113)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌