Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

PTE ACADEMIC

12728303233755

Comments

  • LiolaeusLiolaeus Brisbane, Australia
    Posts: 413Member
    Joined: Dec 06, 2014
    Nope, once lang daanan each question. After clicking next, no going back. Kelangan talaga mindful sa time per question. Check upper right section ng screen para makita yung remaining time. Sa first take ko, hindi naman ako kinulang ng oras, may 5 minutes remaining pa, mali talaga na nag stay ako ng matagal sa mahirap na question.
  • gelotronicgelotronic Singapore
    Posts: 93Member
    Joined: Aug 20, 2014
    edited August 2015
    @smile0127 yep, almost all. Mga 2 questions di ako sigurado, ung technique ko dun e eliminate ung siguradong mali, then choose na lang yung pinakamalapit na mukhang tama hehe.
    Lahat importante, balance dapat

    2014-Aug-13 : ACS Assessment
    2015-Aug-11 : PTE S90 L90 R90 W90
    2015-Dec-28 : EOI 189 261313 - 75 points
    2016-Jan-08 : Invited and Applied Visa
    2016-Jan-11 : Uploaded all docs including Form 80.
    2016-Jan-13: NBI Clearance applied. waiting for release/collection.
    2016-Jan-16 : Medical
    2016-Jan-19 : CO Allocated GSM Adelaide. SG PCC uploaded. Medical screening cleared except for Son.
    2016-Jan-21 : NBI clearances uploaded.
    2016-Jan-28 : Son's Health Clearance Provided. All requested documents uploaded.
    2016-Feb-25 : 2nd CO contact. Form 815 requested and uploaded Same Day.
    2016-Feb-26 : VISA GRANT! Thank you Panginoon!

  • gelotronicgelotronic Singapore
    Posts: 93Member
    Joined: Aug 20, 2014
    @Liolaeus

    Thanks! Importante di ka madistract ng katabi mo, kaya mas malakas boses mo dapat para di mo sila naririnig.

    Nagfocus din ako sa emphasis ng mga key words, ug mga pauses sa mga commas, pati ung sa tono. Dapat pababa ung tono pag patapos na ung sentence. Parang news reporting ba.

    Sa mga graphs, gumamit ng mga synonyms. Dont always use what is written in the graphs

    2014-Aug-13 : ACS Assessment
    2015-Aug-11 : PTE S90 L90 R90 W90
    2015-Dec-28 : EOI 189 261313 - 75 points
    2016-Jan-08 : Invited and Applied Visa
    2016-Jan-11 : Uploaded all docs including Form 80.
    2016-Jan-13: NBI Clearance applied. waiting for release/collection.
    2016-Jan-16 : Medical
    2016-Jan-19 : CO Allocated GSM Adelaide. SG PCC uploaded. Medical screening cleared except for Son.
    2016-Jan-21 : NBI clearances uploaded.
    2016-Jan-28 : Son's Health Clearance Provided. All requested documents uploaded.
    2016-Feb-25 : 2nd CO contact. Form 815 requested and uploaded Same Day.
    2016-Feb-26 : VISA GRANT! Thank you Panginoon!

  • inGodsTimeinGodsTime Posts: 10Member
    Joined: Aug 14, 2015
    edited August 2015
    Hello everyone!
    I took the test yesterday but i failed :(
    Sayang nga hindi ako nakapagprepare ng mabuti
    Nakita ko lng tong thread na to few days before ng exam ko.
    Kung matagal ko na sigurong nalaman about sa forum na to malaking tulong.
    napagawa ako ng account dito kasi gusto ko magpasalamat sa mga taong nagiging inspirasyon sa iba at nagpapalakas ng loob namin wag gumiveup.
    Kahit man iba yung journey ko sainyo... may pagkaparepareho naman tyo
    Ang gusto malagpasan ang pte test
    Shoutout kay @filipinacpa at sa lahat narin na nandito
    Nagsisilbi kayong inspirasyon sa marami
  • filipinacpafilipinacpa Perth
    Posts: 1,085Member, De-activated
    Joined: Jan 24, 2013
    @Liolaeus so lesson na rin sakin yan ngayon na mag aral pa rin ulit at dahil balak ko rin mag take ulit to claim 20 points naman.. hehe.. good luck sis! kaya na yan next time! :)

    @inGodsTime i'm so glad kahit pano nakakatulong kami.. :)

    @gelotronic congratulations!! please share your whole story and tips so I could also share it in the blog to inspire everyone who are aspiring to get their desired scores with PTE :)

    2013-Jan : Decided to pursue my OZ dream
    2013-Nov : 1st Ielts-GT @ BC Manila: L-8;R-6.5;W-7.5;S-7.5
    2014-Mar : 2nd Ielts-GT @ BC Manila: L-8;R-8.5;W-6.5;S-7.5
    Pahinga muna. Sakit sa puso at bulsa!
    2015-May : 1st PTE-A @ Bright Center: L-85;R-70;S-45;W-90
    2015-May : 2nd PTE-A @Bright Center; L-90;R-70;S-47; W-90
    2015-July : 3rd PTE-A @Pearson: L-90;R-77;S-83; W-90
    2015-July 20 - Lodged docs to Vetassess
    2015-Oct 1: VET Positive outcome
    2015-Oct 1: Submitted EOI 190 visa to NSW (55+5)
    2015-Oct 4: Submitted EOI 190 visa to QLD (55+5)
    2015-Oct 5: QLD responded, rejected 190 due to change in occupation list but offered ITA for 489 visa instead
    2015-Nov 2: DIBP points adjusted to 60+5 (due to additional 1 year working experience)
    2015-Nov 26: ITA for SS NSW
    2015-Nov 28: Submitted SS application
    2015-Dec 17: SS Approved + Received 190 ITA
    2015-Dec 23: Lodged 190
    2016-Jan 5: Medical @ Nationwide (Php5,600 na ang fee!!)
    2016-Jan 8: Medical Clearance Provided - no action required (Thank you Lord!)
    2016-Jan 18: Applied for Driving SP and Direct Visa Grant!!! (Thank You Lord!)
    2016-Jan 26: PDOS @ CFO Manila + Enrolled at A1 Driving

    2016-Mar 14: BIG MOVE!:)

    PRAY HARD, WORK HARDER! :)

    Compilation of tips/resources/stories for PTE Academic Preparation: pteacademicreview.wordpress.com
    Template or "cheat sheet" as called by many: https://drive.google.com/file/d/0B1OZBrQj0i5LWU1EYVZTaDF4VzA/view?usp=sharing
    sana po makatulong.. God bless!

  • filipinacpafilipinacpa Perth
    Posts: 1,085Member, De-activated
    Joined: Jan 24, 2013
    @smile0127 use a good headphone. pag wala kasi, macacapture at macacapture yung mga background noises. hence, it couldn't give you a more accurate scores then.

    with regards to summarize written text, eto yung 1 sentence lang tama? short concise po definitely. then make sure to include all the key points of the passage in your sentence. i usually write 30-35 words in 1 sentence.

    2013-Jan : Decided to pursue my OZ dream
    2013-Nov : 1st Ielts-GT @ BC Manila: L-8;R-6.5;W-7.5;S-7.5
    2014-Mar : 2nd Ielts-GT @ BC Manila: L-8;R-8.5;W-6.5;S-7.5
    Pahinga muna. Sakit sa puso at bulsa!
    2015-May : 1st PTE-A @ Bright Center: L-85;R-70;S-45;W-90
    2015-May : 2nd PTE-A @Bright Center; L-90;R-70;S-47; W-90
    2015-July : 3rd PTE-A @Pearson: L-90;R-77;S-83; W-90
    2015-July 20 - Lodged docs to Vetassess
    2015-Oct 1: VET Positive outcome
    2015-Oct 1: Submitted EOI 190 visa to NSW (55+5)
    2015-Oct 4: Submitted EOI 190 visa to QLD (55+5)
    2015-Oct 5: QLD responded, rejected 190 due to change in occupation list but offered ITA for 489 visa instead
    2015-Nov 2: DIBP points adjusted to 60+5 (due to additional 1 year working experience)
    2015-Nov 26: ITA for SS NSW
    2015-Nov 28: Submitted SS application
    2015-Dec 17: SS Approved + Received 190 ITA
    2015-Dec 23: Lodged 190
    2016-Jan 5: Medical @ Nationwide (Php5,600 na ang fee!!)
    2016-Jan 8: Medical Clearance Provided - no action required (Thank you Lord!)
    2016-Jan 18: Applied for Driving SP and Direct Visa Grant!!! (Thank You Lord!)
    2016-Jan 26: PDOS @ CFO Manila + Enrolled at A1 Driving

    2016-Mar 14: BIG MOVE!:)

    PRAY HARD, WORK HARDER! :)

    Compilation of tips/resources/stories for PTE Academic Preparation: pteacademicreview.wordpress.com
    Template or "cheat sheet" as called by many: https://drive.google.com/file/d/0B1OZBrQj0i5LWU1EYVZTaDF4VzA/view?usp=sharing
    sana po makatulong.. God bless!

  • filipinacpafilipinacpa Perth
    Posts: 1,085Member, De-activated
    Joined: Jan 24, 2013
    edited August 2015
    @smile0127 in my case, yung two takes ko ng pte with bright, yung isang summarize written text is pareho and yung dalawa kong essay. Lol

    So i suggest to research on the actual topics provided para may idea sa actual exam.. In reading essays naman is like you are hitting two birds with one stone because you also practice your reading skills here kaya wala mawawala kung magbabasa rin ng ibang sample essays.. :)

    then make sure to follow ielts simon's structure.. same with writefix.. pare pareho lang naman sila.. make sure coherent ang flow ng essay..


    @gelotronic with regards to speaking in a loud voice, I think I will have to agree with this. Soft voice kasi ako but since nasa house lang ako nag take during my practice exam, kaya medyo malakas talaga ang voice ko so siguro mas maganda ang capture ng computer sa boses unlike kung medyo mahina.. the thing is, diba naririnig mo rin sarili mo sa headset kapag nagsasalita ka..so baka mabingi rin ako.. hehe.. pero i'll try it nextime.. thanks for the tip! :)

    2013-Jan : Decided to pursue my OZ dream
    2013-Nov : 1st Ielts-GT @ BC Manila: L-8;R-6.5;W-7.5;S-7.5
    2014-Mar : 2nd Ielts-GT @ BC Manila: L-8;R-8.5;W-6.5;S-7.5
    Pahinga muna. Sakit sa puso at bulsa!
    2015-May : 1st PTE-A @ Bright Center: L-85;R-70;S-45;W-90
    2015-May : 2nd PTE-A @Bright Center; L-90;R-70;S-47; W-90
    2015-July : 3rd PTE-A @Pearson: L-90;R-77;S-83; W-90
    2015-July 20 - Lodged docs to Vetassess
    2015-Oct 1: VET Positive outcome
    2015-Oct 1: Submitted EOI 190 visa to NSW (55+5)
    2015-Oct 4: Submitted EOI 190 visa to QLD (55+5)
    2015-Oct 5: QLD responded, rejected 190 due to change in occupation list but offered ITA for 489 visa instead
    2015-Nov 2: DIBP points adjusted to 60+5 (due to additional 1 year working experience)
    2015-Nov 26: ITA for SS NSW
    2015-Nov 28: Submitted SS application
    2015-Dec 17: SS Approved + Received 190 ITA
    2015-Dec 23: Lodged 190
    2016-Jan 5: Medical @ Nationwide (Php5,600 na ang fee!!)
    2016-Jan 8: Medical Clearance Provided - no action required (Thank you Lord!)
    2016-Jan 18: Applied for Driving SP and Direct Visa Grant!!! (Thank You Lord!)
    2016-Jan 26: PDOS @ CFO Manila + Enrolled at A1 Driving

    2016-Mar 14: BIG MOVE!:)

    PRAY HARD, WORK HARDER! :)

    Compilation of tips/resources/stories for PTE Academic Preparation: pteacademicreview.wordpress.com
    Template or "cheat sheet" as called by many: https://drive.google.com/file/d/0B1OZBrQj0i5LWU1EYVZTaDF4VzA/view?usp=sharing
    sana po makatulong.. God bless!

  • vanna026vanna026 Mandaluyong
    Posts: 8Member
    Joined: Jun 06, 2015
    Hi po? How much po ang practice test at mganda bilhin?
  • Georgie335Georgie335 Makati
    Posts: 90Member
    Joined: Sep 06, 2014
    60 dollars ung binili ko. D dapat tinitipid ang future naten hehe.
  • filipinacpafilipinacpa Perth
    Posts: 1,085Member, De-activated
    Joined: Jan 24, 2013
    @Zaire tama! hehe

    2013-Jan : Decided to pursue my OZ dream
    2013-Nov : 1st Ielts-GT @ BC Manila: L-8;R-6.5;W-7.5;S-7.5
    2014-Mar : 2nd Ielts-GT @ BC Manila: L-8;R-8.5;W-6.5;S-7.5
    Pahinga muna. Sakit sa puso at bulsa!
    2015-May : 1st PTE-A @ Bright Center: L-85;R-70;S-45;W-90
    2015-May : 2nd PTE-A @Bright Center; L-90;R-70;S-47; W-90
    2015-July : 3rd PTE-A @Pearson: L-90;R-77;S-83; W-90
    2015-July 20 - Lodged docs to Vetassess
    2015-Oct 1: VET Positive outcome
    2015-Oct 1: Submitted EOI 190 visa to NSW (55+5)
    2015-Oct 4: Submitted EOI 190 visa to QLD (55+5)
    2015-Oct 5: QLD responded, rejected 190 due to change in occupation list but offered ITA for 489 visa instead
    2015-Nov 2: DIBP points adjusted to 60+5 (due to additional 1 year working experience)
    2015-Nov 26: ITA for SS NSW
    2015-Nov 28: Submitted SS application
    2015-Dec 17: SS Approved + Received 190 ITA
    2015-Dec 23: Lodged 190
    2016-Jan 5: Medical @ Nationwide (Php5,600 na ang fee!!)
    2016-Jan 8: Medical Clearance Provided - no action required (Thank you Lord!)
    2016-Jan 18: Applied for Driving SP and Direct Visa Grant!!! (Thank You Lord!)
    2016-Jan 26: PDOS @ CFO Manila + Enrolled at A1 Driving

    2016-Mar 14: BIG MOVE!:)

    PRAY HARD, WORK HARDER! :)

    Compilation of tips/resources/stories for PTE Academic Preparation: pteacademicreview.wordpress.com
    Template or "cheat sheet" as called by many: https://drive.google.com/file/d/0B1OZBrQj0i5LWU1EYVZTaDF4VzA/view?usp=sharing
    sana po makatulong.. God bless!

  • Urlilangel_christyUrlilangel_christy Dubai
    Posts: 20Member
    Joined: May 26, 2015
    @julian tnx sa feedback. I'm setting myself to take sa september. basa basa muna regarding the pte a. anytime naman pwede magpa sched dito daming vacancy.

    @eischied_21 eto yung link ( credit to the sources dito din - kinuha ko lang ) https://www.dropbox.com/sh/6wkpy2tzxkgkji2/AABVjuEHVVKPpeJ_n14_s1sya?dl=0

    @filipinacpa in the previous comment meron kang binigay na cheat notes.. pwde makahingi :). Thank you in advance and thank you for making this thread. Nabuhay ang dugo ko ulit sis . God Bless
  • kittykitkat18kittykitkat18 Sydney
    Posts: 908Member
    Joined: May 13, 2015
    @Urlilangel_christy san ka magtake?si hubby sept din pro sa sg

    Computer network and systems engineer (263111) - Hubby is main applicant - Mapua (BS-ECE)
    07.23.15 - submitted ACS
    07.27.15 - ACS result - suitable..AQF Bachelor. 2 yrs deduction. 5yrs and 10 mos credited
    09.28.15 - PTE scheduled exam (Sg)
    09.29.15 - PTE Results. L - 90, R - 86, S - 90, W - 86. Overall = 90
    09.30.15 - Submitted EOI Visa 189 - 70 pts
    10.09.15 - Invitation received
    10.28.15 - medicals (me & hubby) @ Point Medical Sg
    11.11.15 - NBI (me, hubby and mother)
    11.16.15 - medicals of mother @ St Lukes BGC
    11.22.15 - Lodged Visa
    11.25.15 - Frontloaded docs and requested SG CoC
    12.01.15 - CO Allocated. Request form 47a for mother
    12.02.15 - Frontloaded SG CoC (me & hubby) and form 47a
    02.09.16 - called GSM Adelaide for follow-up (71 days from CO contact)
    02.15.16 - granted! Thank you for the Blessings
    Dependent parent rejected. CO not satisfied with one of the requirements for dependency (part of household unit)
    07.28.16 - Big move! Sydney here we go!
    09.19.16 - Start of work
    09.22.16 - Hubby start of work
    06.19.17 - Hubby's new work
    11.16.17 - hello Baby!
    Jesus, I Trust In You

  • Urlilangel_christyUrlilangel_christy Dubai
    Posts: 20Member
    Joined: May 26, 2015
    edited August 2015
    @kittykitkat18 sa abu dhabi.

    Katanungan lang po ulit. yung sequence ng exam : speaking , writing , reading , listening--- for 3 hrs, same day. Naka IELTS set mode pa kasi utak ko.

    Sa lahat po ng naka-take. Ang speaking and writing and listening given na that it is timed test. may specific allocation kung ilang oras mo gagawin ang test at makikita cya on screen ang progress. Sa Reading ba timed din ?..kasi base sa nabasa ko wala kasing nakalagay ilang oras ang uukulin mo bawat question may alloted time lang na nakalagay na 37-41 minutes, Para ma practice namin ang pacing ng exam.
  • Georgie335Georgie335 Makati
    Posts: 90Member
    Joined: Sep 06, 2014
    Another quick question for those who took the exam na, may timer ba ung speaking part pag irerecord mo na ung sarili mo? For example, you have to speak 40 seconds max, may progress bar ba or you have to count it at the back of your head while answering?
  • Urlilangel_christyUrlilangel_christy Dubai
    Posts: 20Member
    Joined: May 26, 2015
    @zaire nakita ko sa pearson sample exam may timer na nakaindicate sa screen ng pc so alam mo kung ilang seconds na lang meron ka or in progress record.
  • Georgie335Georgie335 Makati
    Posts: 90Member
    Joined: Sep 06, 2014
    Yun nga e, but I saw sa other forum na wala daw? which I think is misleading.
  • inGodsGrace_inGodsGrace_ Posts: 44Member
    Joined: Jul 17, 2015
    Hi guys! Hubby was doing the practice exam a while ago kaso we had a very slow connection, ok lang ba yun na he saved it? Kasi may resume din naman. tIA!

    Hubby is the applicant
    Anzco 261313 - Software Engineer
    July 3, 2015 - Submitted Docs for ACS
    July 9, 2015 - Received suitable results (thank you Lord)
    August 20, 2015 - PTE

  • gelotronicgelotronic Singapore
    Posts: 93Member
    Joined: Aug 20, 2014
    @filipinacpa di ko nadidinig voice ko sa handset, so ok lang hehehe. Before exam starts, merong test recording,naka 3 beses ko tinest talaga yung recording, mejo bassy kase di ko nagustuhan, sabi ko bahala na basta clear voice.

    Ok i' ll share again more of my personal observations on my exam. Sana makatulong.

    1. I focus more on technicalities like yung exact order of test categories, like sa simula ay read aloud, and so on. Para di ko na kelangan basahin ung directions sa screen.

    2. Sa answer the question, 1word lang talaga ung answer ko. And make sure that recording started, baka kase di mairecord kapag sumagot ka kaagad after the question.

    Wala na ko maisip...tanong lang kayo dito at sasagutan ko sa abot ng makakaya ko.

    Cheers!

    2014-Aug-13 : ACS Assessment
    2015-Aug-11 : PTE S90 L90 R90 W90
    2015-Dec-28 : EOI 189 261313 - 75 points
    2016-Jan-08 : Invited and Applied Visa
    2016-Jan-11 : Uploaded all docs including Form 80.
    2016-Jan-13: NBI Clearance applied. waiting for release/collection.
    2016-Jan-16 : Medical
    2016-Jan-19 : CO Allocated GSM Adelaide. SG PCC uploaded. Medical screening cleared except for Son.
    2016-Jan-21 : NBI clearances uploaded.
    2016-Jan-28 : Son's Health Clearance Provided. All requested documents uploaded.
    2016-Feb-25 : 2nd CO contact. Form 815 requested and uploaded Same Day.
    2016-Feb-26 : VISA GRANT! Thank you Panginoon!

  • Georgie335Georgie335 Makati
    Posts: 90Member
    Joined: Sep 06, 2014
    edited August 2015
    @gelotronic or anyone who took the exam, can I get a clarification about the following?

    1.) about the timer - may timer ba ung speaking part pag irerecord mo na ung sarili mo? For example, you have to speak 40 seconds max during a retell lecture, may progress bar ba or you have to count it at the back of your head while answering?
    2.) Gumagana ba ang keyboard shortcuts? Madalas kong gamitin, Control+C, Control+V, Control+Z, Home, End, Shift+Up, Shift+Left.

    Thanks,
    Zaire
  • gelotronicgelotronic Singapore
    Posts: 93Member
    Joined: Aug 20, 2014
    1. Merong timer and progress bar.
    2. Ung mga ctrl functions like ctrl-x, ctrl-c, di ko na ginamit. So di ko na-try kung gumagana. Ang ginamit ko ung cut,copy, and paste buttons sa screen.
    Ung mga home, end, gumagana.

    2014-Aug-13 : ACS Assessment
    2015-Aug-11 : PTE S90 L90 R90 W90
    2015-Dec-28 : EOI 189 261313 - 75 points
    2016-Jan-08 : Invited and Applied Visa
    2016-Jan-11 : Uploaded all docs including Form 80.
    2016-Jan-13: NBI Clearance applied. waiting for release/collection.
    2016-Jan-16 : Medical
    2016-Jan-19 : CO Allocated GSM Adelaide. SG PCC uploaded. Medical screening cleared except for Son.
    2016-Jan-21 : NBI clearances uploaded.
    2016-Jan-28 : Son's Health Clearance Provided. All requested documents uploaded.
    2016-Feb-25 : 2nd CO contact. Form 815 requested and uploaded Same Day.
    2016-Feb-26 : VISA GRANT! Thank you Panginoon!

  • kristine_1377kristine_1377 Mandaluyong
    Posts: 56Member
    Joined: Feb 19, 2011
    @gelotronic anong part ng exam mo ginamit yung cut,copy and paste?
  • gelotronicgelotronic Singapore
    Posts: 93Member
    Joined: Aug 20, 2014
    @kristine_1377 Essay writing. Madali mag arrange ng sentence at paragraphs pag merong cut and paste.

    2014-Aug-13 : ACS Assessment
    2015-Aug-11 : PTE S90 L90 R90 W90
    2015-Dec-28 : EOI 189 261313 - 75 points
    2016-Jan-08 : Invited and Applied Visa
    2016-Jan-11 : Uploaded all docs including Form 80.
    2016-Jan-13: NBI Clearance applied. waiting for release/collection.
    2016-Jan-16 : Medical
    2016-Jan-19 : CO Allocated GSM Adelaide. SG PCC uploaded. Medical screening cleared except for Son.
    2016-Jan-21 : NBI clearances uploaded.
    2016-Jan-28 : Son's Health Clearance Provided. All requested documents uploaded.
    2016-Feb-25 : 2nd CO contact. Form 815 requested and uploaded Same Day.
    2016-Feb-26 : VISA GRANT! Thank you Panginoon!

  • g_whing_whin İstanbul
    Posts: 26Member
    Joined: May 24, 2014
    @gelotronic Can you give specifics regarding describe image and re-tell lecture. Such as what's going on your mind, how did you frame your answers or techniques you used on note taking.
  • gelotronicgelotronic Singapore
    Posts: 93Member
    Joined: Aug 20, 2014
    edited August 2015
    @g_whin ok, in my exam, i mostly got describe graphs, my steps in describing are:
    1. Tell the title of the graph.
    2. Describe the x-axis, then the y-axis.
    3. Explain the key points in the graph, as you observe it. Like telling where is the minimum or maximum values, which has the smallest or greatest, etc.
    4. If you still have some seconds left, just talk and explain whatever you see in the image or graph, until you reach 40secs.

    For retell, my first sentence should be telling the topic, and summary of the whole lecture. And supporting lines were from keynotes i wrote while listening.
    You should write the keywords, so you will have enough to say until you reach 40secs.

    For both, i always made sure to have correct grammar, correct pronunciation, use synonyms instead of repeating to say again key words.

    2014-Aug-13 : ACS Assessment
    2015-Aug-11 : PTE S90 L90 R90 W90
    2015-Dec-28 : EOI 189 261313 - 75 points
    2016-Jan-08 : Invited and Applied Visa
    2016-Jan-11 : Uploaded all docs including Form 80.
    2016-Jan-13: NBI Clearance applied. waiting for release/collection.
    2016-Jan-16 : Medical
    2016-Jan-19 : CO Allocated GSM Adelaide. SG PCC uploaded. Medical screening cleared except for Son.
    2016-Jan-21 : NBI clearances uploaded.
    2016-Jan-28 : Son's Health Clearance Provided. All requested documents uploaded.
    2016-Feb-25 : 2nd CO contact. Form 815 requested and uploaded Same Day.
    2016-Feb-26 : VISA GRANT! Thank you Panginoon!

  • kristine_1377kristine_1377 Mandaluyong
    Posts: 56Member
    Joined: Feb 19, 2011
    @gelotronic dun sa describe image nagsabi ka ba ng trend?
  • gelotronicgelotronic Singapore
    Posts: 93Member
    Joined: Aug 20, 2014
    @kristine_1377

    Pag line graphs, oo sinabi ko ung trend, kung kelan bumaba at tumaas. Pandagdag sa sasabihin para makumpleto ung 40secs

    2014-Aug-13 : ACS Assessment
    2015-Aug-11 : PTE S90 L90 R90 W90
    2015-Dec-28 : EOI 189 261313 - 75 points
    2016-Jan-08 : Invited and Applied Visa
    2016-Jan-11 : Uploaded all docs including Form 80.
    2016-Jan-13: NBI Clearance applied. waiting for release/collection.
    2016-Jan-16 : Medical
    2016-Jan-19 : CO Allocated GSM Adelaide. SG PCC uploaded. Medical screening cleared except for Son.
    2016-Jan-21 : NBI clearances uploaded.
    2016-Jan-28 : Son's Health Clearance Provided. All requested documents uploaded.
    2016-Feb-25 : 2nd CO contact. Form 815 requested and uploaded Same Day.
    2016-Feb-26 : VISA GRANT! Thank you Panginoon!

  • g_whing_whin İstanbul
    Posts: 26Member
    Joined: May 24, 2014
    @gelotronic One last question from me. How fast was your speech? There was a tip given on this forum that she patterned her speech rate with the sample response given on some PTE materials. Though personally when I heard those read a loud sample response, I felt that it was really fast. The materials that I am referring are the one with B1, B2 and C1 response. Can you please share your insights and experience? Thank you in advance
  • gelotronicgelotronic Singapore
    Posts: 93Member
    Joined: Aug 20, 2014
    edited August 2015
    @g_whin sorry i never listened to the sample response from PTE materials, so i cant compare. In all speaking questions, i tried to maintain pace similar to how news reporter reports, parang sa CNN, CNBC, fox news, etc. Minsan napapabilis kase rapper ako hahaha.
    And pinoy accent pa rin kase yun ang pinakakomportable.
    And kelangan may pauses to show punctuation like commas, periods. and emphasize keywords. Mas malakas at madiin ung mga importante words.
    Hope this helps.

    2014-Aug-13 : ACS Assessment
    2015-Aug-11 : PTE S90 L90 R90 W90
    2015-Dec-28 : EOI 189 261313 - 75 points
    2016-Jan-08 : Invited and Applied Visa
    2016-Jan-11 : Uploaded all docs including Form 80.
    2016-Jan-13: NBI Clearance applied. waiting for release/collection.
    2016-Jan-16 : Medical
    2016-Jan-19 : CO Allocated GSM Adelaide. SG PCC uploaded. Medical screening cleared except for Son.
    2016-Jan-21 : NBI clearances uploaded.
    2016-Jan-28 : Son's Health Clearance Provided. All requested documents uploaded.
    2016-Feb-25 : 2nd CO contact. Form 815 requested and uploaded Same Day.
    2016-Feb-26 : VISA GRANT! Thank you Panginoon!

  • poochy500poochy500 Braddon
    Posts: 146Member
    Joined: Oct 13, 2014
    Isa nalang pala ang venue ng PTE exam ano? Nung nag exam ako meron pa sa Ortigas at hindi pa ganun gaano kakilala ang PTE.. Ngayon halos yung isang buwan fully booked na..

    Goodluck to all.

    -

    263111

    March 30 2015 - Submitted ACS assessment
    April 2 2015 - ACS Result, suitable (AQF Bachelor Degree, 6+ yrs exp) (15 pts) Thank You Lord!!
    May 9 2015 - PTE results - passed!! 10 pts
    May 10 2015 - Submitted EOI visa 189 - 65 points
    May 22 2015 - Invited to apply
    May 23 2015 - Lodged and paid visa 189
    June 8 2015 - Medicals completed at St. Luke's BGC
    July 13 2015 - Direct Grant!! Thank you Lord!!

  • smile0127smile0127 Melbourne
    Posts: 11Member
    Joined: Aug 13, 2015
    @filipinacpa thank you Po sa reply. I rescheduled my exam sa September. Kesa sumugod ako Ng sumugod. I'll keep in mind Po lahat Ng advices nyo. @gelotronic anu Po mas Mahirap ang questions yung mock test online o yung actual exam Po? Thanks Po.
Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

engrdkGeorgeLeeHezronrecardopinoisaudiboi8988iblessycardo suberiekxiaoluCORTESJAYJLEvaristonayabrayajpearlthefishthekneelawelynneislovelaurenceoliveralbaAybandanielTsiSenJuven1016rapsgalbertus1982
Browse Members

Members Online (0) + Guest (106)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌