Ad space available
reach us at pinoyau@gmail.com.
Hey Everyone! Admin here, It's a bit overdue but I will be migrating our forum site to a new platform for better security. I will take out all the ads as well as these pesky spammers. Please expect a bit of issues here and there, and will slowly move the features to the new one. Don't worry we are very much alive and will be alive as long as I'm here :)

Melbourne Big Move

24567

Comments

  • johnvangiejohnvangie Melbourne
    Posts: 686Member
    Joined: Oct 14, 2013
    @persephone30 hi sis..pa-join ako..I'm planning to enter Melby by December and move permanently by May..musta preparation sis? :)
    @MsVi
    Melby din kayo, saya naman, madami na tayo dito.

    Ano FB mo sis?


    Nominated Occupation : Production or Plant Engineer 233513
    12/15/13 - IELTS IDP [ L : 9.0 I R :8.0 I S : 7.5 I W : 6.5 ]
    01/17/14 - Submit CDR to Engineers Australia.
    02/15/14 - IELTS IDP [ L : 9.0 I R :9.0 I S : 7.5 I W : 7.0 ]
    05/29/14 - EA positive assessment as Production or Plant Engineer 233513
    06/02/14 - EA Letter Received. Lodge EOI 65points.
    06/09/14 - Received invitation to lodge Visa 189.
    06/12/14 - Lodge Visa 189. Upload Docs/Form 80.
    07/14/14 - Medicals @ SLEC Global.
    07/15/14 - Upload NBI. (NBI Valid until July 4, 2015).
    07/17/14 - CO Allocated. Team 7 GSM Adelaide ( CO : LM )
    07/21/14 - VISA GRANT! Thank You Lord! IED : 07/04/15
    02/06/15 - Hubby in Melbourne (Jobhunting)
    03/27/15 - Me and my son in Melbourne
    04/07/15 - Hubby 1st day of job
    08/24/15 - My 1st day in BP, Thank you Lord God Jesus!

    Enjoying the wonderful life in Oz, abundant blessings indeed :-)

  • persephone30persephone30 Los Angeles
    Posts: 162Member
    Joined: Jan 21, 2014
    @johnvangie Cge sis pm kita hehe... Big move ko baka mid or late next yr..latest na eh jan 2017.

    Computer Network and Systems Engineer
    Jan. 2014 - Decided to finally pursue AU Immigration
    Feb. 9, 2014 - Applied for ACS Assessment
    Mar.15, 2014 - Took IELTS Exam @IDP
    Mar. 28, 2014 - IELTS Score: L:8.5; R:9.0; S:7.0; W:6.5
    Apr. 2, 2014 - Applied for remarking
    Apr. 16, 2014 - ACS result suitable
    May 17, 2014 - Retake IELTS @IDP
    May 30, 2014 - IELTS Score: L:8.0; R:9.0; S:7.0; W:7.0
    June 10, 2014 - IELTS Remarking successful! (New IELTS Score: L:8.5; R:9.0; S:7.0; W:7.0)
    June 14, 2014 - Submitted EOI & VIC SS
    June 17, 2014 - updated EOI to uncheck Visa 189 and include Mom as dependent; VIC confirmed Mom is added as dependent.
    Oct. 06,2014 - VIC SS Successful; Invited for Visa 190. Submitted My Health Declaration
    Oct. 15, 2014 - Mom & Baby Medicals @ Cebu Doctor's
    Nov. 11, 2014 - My Medical done at Point Medical
    Nov. 20, 2014 - Requested NBI again via Ms. Sandra
    Nov. 21, 2014 - Lodged Visa 190
    Nov. 25, 2014 - Requested SG PCC
    Dec. 03, 2014 - Received NBI Clearance
    Dec. 04, 2014 - emailed VIC of TRN and status of application
    Dec. 05, 2014 - Collected SG PCC
    Jan. 06, 2015 - Direct Grant! Thank you God!!! GSM Brisbane - Team 33 (IED: Oct 21, 2015)

  • johnvangiejohnvangie Melbourne
    Posts: 686Member
    Joined: Oct 14, 2013
    @persephone30
    Ah tagal pa pala.
    Ok sis.

    Nominated Occupation : Production or Plant Engineer 233513
    12/15/13 - IELTS IDP [ L : 9.0 I R :8.0 I S : 7.5 I W : 6.5 ]
    01/17/14 - Submit CDR to Engineers Australia.
    02/15/14 - IELTS IDP [ L : 9.0 I R :9.0 I S : 7.5 I W : 7.0 ]
    05/29/14 - EA positive assessment as Production or Plant Engineer 233513
    06/02/14 - EA Letter Received. Lodge EOI 65points.
    06/09/14 - Received invitation to lodge Visa 189.
    06/12/14 - Lodge Visa 189. Upload Docs/Form 80.
    07/14/14 - Medicals @ SLEC Global.
    07/15/14 - Upload NBI. (NBI Valid until July 4, 2015).
    07/17/14 - CO Allocated. Team 7 GSM Adelaide ( CO : LM )
    07/21/14 - VISA GRANT! Thank You Lord! IED : 07/04/15
    02/06/15 - Hubby in Melbourne (Jobhunting)
    03/27/15 - Me and my son in Melbourne
    04/07/15 - Hubby 1st day of job
    08/24/15 - My 1st day in BP, Thank you Lord God Jesus!

    Enjoying the wonderful life in Oz, abundant blessings indeed :-)

  • FilozFiloz Melbourne
    Posts: 185Member
    Joined: Nov 08, 2012
    @johnvangie @MsVi @persephone30 Pajoin po :) Wow sa mga nabasa ko po lalo ako naexcite pumunta sa Melby :) Sayang po at hindi namin aabutan ang tulip festival sa initial entry namin. Hope to see you all!

    Accountant (General): 221111
    Primary Applicant: Husband
    01/29/2013 - IELTS results L-8.5 R-8.0 W-8.0 S-9.0
    05/26/2014 - CPA AU Professional Title granted by CPA Australia
    06/02/2014 - Submitted and paid CPAA Migration Assessment
    07/04/2014 - Assessment by CPAA 11/12 (Questioning about Accounting Theory)
    08/04/2014 - Sent Appeal Letter with all the supporting Documents to CPAA
    08/29/2014 - Received Complete CPAA Assessment Result 12/12 (Academically Suitable for Migration)
    12/12/2014 - Received CPAA Skilled Employment Assessment
    03/26/2015 - Submitted EOI for 189 (75pts)
    03/27/2015 - Invited to apply Visa 189
    04/06/2015 - Lodged Visa 189
    05/02/2015 - Medicals at Gulf X-ray and Laboratories Doha
    05/06/2015 - Medicals Uploaded
    05/12/2015 - Received NBI from Representative in PH. Uploaded NBI
    05/18/2015 - CO Allocated. Same day Uploaded additional Docs.
    05/22/2015 - Received Delay Email
    07/02/2015 - VISA GRANT! Thank you Lord!
    08/21/2015 - Initial Entry Completed (Melbourne)
    May 2016 - Husband got a Job Offer
    June 2016 - Big Move Melbourne

    All for the Greater Glory of GOD!!!
    Proverbs 16:3 Commit your work to the Lord, and your plans will be established.

  • MsViMsVi Melbourne
    Posts: 69Member
    Joined: Sep 11, 2014
    @Filoz Kelan po initial entry nyo?

    07-23-2014 Submitted docs to ACS 2631111 (Computer Network and Systems Professional)
    08-02-2014 IELTS IDP exam
    08-15-2014 LRWS/6.5 (retake)
    08-18-2014 ACS result suitable Bachelors degree minor in computing (deducted 6yrs work exp)
    09-20-2014 IELTS IDP exam
    10-03-2014 LRWS result 8 8 6 7
    04-11-2015 PTE Academic 75 75 76 73
    04-13-2015 Submitted EOI 189
    05-08-2015 ITA received
    05-10-2015 Visa lodge
    05-25-2015 Medical at BGC
    07-02-2015 Direct visa grant (Thank you God!)

  • FilozFiloz Melbourne
    Posts: 185Member
    Joined: Nov 08, 2012
    @MsVi Next week na po :) Naghahanda na sa malamig na weather sana po kayanin dahil galing kami dito ngayon sa 45-50 degrees na weather hehehe :) 9 days lang po kami sa Melby then next year na ang Big Move ipon pa more. ;)

    Accountant (General): 221111
    Primary Applicant: Husband
    01/29/2013 - IELTS results L-8.5 R-8.0 W-8.0 S-9.0
    05/26/2014 - CPA AU Professional Title granted by CPA Australia
    06/02/2014 - Submitted and paid CPAA Migration Assessment
    07/04/2014 - Assessment by CPAA 11/12 (Questioning about Accounting Theory)
    08/04/2014 - Sent Appeal Letter with all the supporting Documents to CPAA
    08/29/2014 - Received Complete CPAA Assessment Result 12/12 (Academically Suitable for Migration)
    12/12/2014 - Received CPAA Skilled Employment Assessment
    03/26/2015 - Submitted EOI for 189 (75pts)
    03/27/2015 - Invited to apply Visa 189
    04/06/2015 - Lodged Visa 189
    05/02/2015 - Medicals at Gulf X-ray and Laboratories Doha
    05/06/2015 - Medicals Uploaded
    05/12/2015 - Received NBI from Representative in PH. Uploaded NBI
    05/18/2015 - CO Allocated. Same day Uploaded additional Docs.
    05/22/2015 - Received Delay Email
    07/02/2015 - VISA GRANT! Thank you Lord!
    08/21/2015 - Initial Entry Completed (Melbourne)
    May 2016 - Husband got a Job Offer
    June 2016 - Big Move Melbourne

    All for the Greater Glory of GOD!!!
    Proverbs 16:3 Commit your work to the Lord, and your plans will be established.

  • MsViMsVi Melbourne
    Posts: 69Member
    Joined: Sep 11, 2014
    @Filoz wow ambilis..same tayo ng date ng grant..let's all keep in touch para may support group tayo pag nasa Melbourne na tayo.. :)

    07-23-2014 Submitted docs to ACS 2631111 (Computer Network and Systems Professional)
    08-02-2014 IELTS IDP exam
    08-15-2014 LRWS/6.5 (retake)
    08-18-2014 ACS result suitable Bachelors degree minor in computing (deducted 6yrs work exp)
    09-20-2014 IELTS IDP exam
    10-03-2014 LRWS result 8 8 6 7
    04-11-2015 PTE Academic 75 75 76 73
    04-13-2015 Submitted EOI 189
    05-08-2015 ITA received
    05-10-2015 Visa lodge
    05-25-2015 Medical at BGC
    07-02-2015 Direct visa grant (Thank you God!)

  • FilozFiloz Melbourne
    Posts: 185Member
    Joined: Nov 08, 2012
    @MsVi Yey! Oo nga Team April ka din pala PM kita sis. Sure po para kitakits tayo dun soon :) :) :) Dapat October pa yung initial namin kaso may new work na nagwait sa akin dito sa Sept kaya need lumipad agad para pagbalik sis ipon mode na ito hehehe. :)

    Accountant (General): 221111
    Primary Applicant: Husband
    01/29/2013 - IELTS results L-8.5 R-8.0 W-8.0 S-9.0
    05/26/2014 - CPA AU Professional Title granted by CPA Australia
    06/02/2014 - Submitted and paid CPAA Migration Assessment
    07/04/2014 - Assessment by CPAA 11/12 (Questioning about Accounting Theory)
    08/04/2014 - Sent Appeal Letter with all the supporting Documents to CPAA
    08/29/2014 - Received Complete CPAA Assessment Result 12/12 (Academically Suitable for Migration)
    12/12/2014 - Received CPAA Skilled Employment Assessment
    03/26/2015 - Submitted EOI for 189 (75pts)
    03/27/2015 - Invited to apply Visa 189
    04/06/2015 - Lodged Visa 189
    05/02/2015 - Medicals at Gulf X-ray and Laboratories Doha
    05/06/2015 - Medicals Uploaded
    05/12/2015 - Received NBI from Representative in PH. Uploaded NBI
    05/18/2015 - CO Allocated. Same day Uploaded additional Docs.
    05/22/2015 - Received Delay Email
    07/02/2015 - VISA GRANT! Thank you Lord!
    08/21/2015 - Initial Entry Completed (Melbourne)
    May 2016 - Husband got a Job Offer
    June 2016 - Big Move Melbourne

    All for the Greater Glory of GOD!!!
    Proverbs 16:3 Commit your work to the Lord, and your plans will be established.

  • FilozFiloz Melbourne
    Posts: 185Member
    Joined: Nov 08, 2012
    @MsVi Ay mali Team May pala sis hehehe :) Ang aming mga kapatid (Team April). PM kita sis ;)

    Accountant (General): 221111
    Primary Applicant: Husband
    01/29/2013 - IELTS results L-8.5 R-8.0 W-8.0 S-9.0
    05/26/2014 - CPA AU Professional Title granted by CPA Australia
    06/02/2014 - Submitted and paid CPAA Migration Assessment
    07/04/2014 - Assessment by CPAA 11/12 (Questioning about Accounting Theory)
    08/04/2014 - Sent Appeal Letter with all the supporting Documents to CPAA
    08/29/2014 - Received Complete CPAA Assessment Result 12/12 (Academically Suitable for Migration)
    12/12/2014 - Received CPAA Skilled Employment Assessment
    03/26/2015 - Submitted EOI for 189 (75pts)
    03/27/2015 - Invited to apply Visa 189
    04/06/2015 - Lodged Visa 189
    05/02/2015 - Medicals at Gulf X-ray and Laboratories Doha
    05/06/2015 - Medicals Uploaded
    05/12/2015 - Received NBI from Representative in PH. Uploaded NBI
    05/18/2015 - CO Allocated. Same day Uploaded additional Docs.
    05/22/2015 - Received Delay Email
    07/02/2015 - VISA GRANT! Thank you Lord!
    08/21/2015 - Initial Entry Completed (Melbourne)
    May 2016 - Husband got a Job Offer
    June 2016 - Big Move Melbourne

    All for the Greater Glory of GOD!!!
    Proverbs 16:3 Commit your work to the Lord, and your plans will be established.

  • bellesolisbellesolis Quezon City
    Posts: 15Member
    Joined: Jul 31, 2015
    Hi po, thanks po very impormative yung mga shares po ninyo.

    Kami naman po ng hubby ko maybe by JANUARY 2016 po maka-move sa Melby,, as Student Visa po siya papasok, kasama nya po ako :-) madali po bang makahanap ng work kung STUDENT visa hawak ng asawa ko? Sa akin naman po, di naman po siguro ako magkaka-problem sa paghanap ng work?

    Thanks po in advance.
  • J_OzJ_Oz Sydney
    Posts: 1,002Member
    Joined: Jun 05, 2014
    @MsVi Next week na po :) Naghahanda na sa malamig na weather sana po kayanin dahil galing kami dito ngayon sa 45-50 degrees na weather hehehe :) 9 days lang po kami sa Melby then next year na ang Big Move ipon pa more. ;)

    Pasalubong po :) Enjoy your stay in Melby. hehe

    Developer Programmer (261312)
    08.25.2014: Completed gathering of documents
    08.29.2014: ACS Skills Assessment
    09.09.2014: ACS Result - OK - Thank you Lord!
    10.18.2014: IELTS IDP Makati
    10.31.2014: IELTS- R:8.5 L:7.5 S:7 W:7 - OBS:7.5) - Thank you Lord!
    02.03.2015: Submitted EOI
    02.26.2015: Received ITA 189
    04.24.2015: Lodged Visa - Day 1
    04.25.2015: Uploaded docs - Day 2
    05.08.2015: Wife NBI Clearance - Day 15 || 05.25.2015: Uploaded NBI Clearance - Day 32
    05.28.2015: Medicals @ SLEC BGC Day 35
    05.30.2015: Medicals Finalised - Day 37
    06.11.2015: CO Allocated - Day 48
    07.02.2015 - Visa Granted! Thank you LORD! Glory to God!
    10.15.2015 - Arrived in SYD - Jer 29:11

  • FilozFiloz Melbourne
    Posts: 185Member
    Joined: Nov 08, 2012
    @J_Oz hahaha Salamat Bro! Kitakits soon! ;)

    Accountant (General): 221111
    Primary Applicant: Husband
    01/29/2013 - IELTS results L-8.5 R-8.0 W-8.0 S-9.0
    05/26/2014 - CPA AU Professional Title granted by CPA Australia
    06/02/2014 - Submitted and paid CPAA Migration Assessment
    07/04/2014 - Assessment by CPAA 11/12 (Questioning about Accounting Theory)
    08/04/2014 - Sent Appeal Letter with all the supporting Documents to CPAA
    08/29/2014 - Received Complete CPAA Assessment Result 12/12 (Academically Suitable for Migration)
    12/12/2014 - Received CPAA Skilled Employment Assessment
    03/26/2015 - Submitted EOI for 189 (75pts)
    03/27/2015 - Invited to apply Visa 189
    04/06/2015 - Lodged Visa 189
    05/02/2015 - Medicals at Gulf X-ray and Laboratories Doha
    05/06/2015 - Medicals Uploaded
    05/12/2015 - Received NBI from Representative in PH. Uploaded NBI
    05/18/2015 - CO Allocated. Same day Uploaded additional Docs.
    05/22/2015 - Received Delay Email
    07/02/2015 - VISA GRANT! Thank you Lord!
    08/21/2015 - Initial Entry Completed (Melbourne)
    May 2016 - Husband got a Job Offer
    June 2016 - Big Move Melbourne

    All for the Greater Glory of GOD!!!
    Proverbs 16:3 Commit your work to the Lord, and your plans will be established.

  • manongkomanongko Singapore
    Posts: 3Member
    Joined: Aug 12, 2015
    @Futures

    New ako dto sa forum and ngbabalak kami pumunta nga oz.
    Sang website makakuha ng for rent n room if our PR is approved. San place sa oz usually in demand ang civil engr and architect. We are planning to move with my 2 kids.
    Thanks and hoping for your inputs.
  • johnvangiejohnvangie Melbourne
    Posts: 686Member
    Joined: Oct 14, 2013
    @johnvangie @MsVi @persephone30 Pajoin po :) Wow sa mga nabasa ko po lalo ako naexcite pumunta sa Melby :) Sayang po at hindi namin aabutan ang tulip festival sa initial entry namin. Hope to see you all!
    Hello, welcome to Melbourne @Filoz

    San kayo dito mag stay sa initial entry nyo?

    Nominated Occupation : Production or Plant Engineer 233513
    12/15/13 - IELTS IDP [ L : 9.0 I R :8.0 I S : 7.5 I W : 6.5 ]
    01/17/14 - Submit CDR to Engineers Australia.
    02/15/14 - IELTS IDP [ L : 9.0 I R :9.0 I S : 7.5 I W : 7.0 ]
    05/29/14 - EA positive assessment as Production or Plant Engineer 233513
    06/02/14 - EA Letter Received. Lodge EOI 65points.
    06/09/14 - Received invitation to lodge Visa 189.
    06/12/14 - Lodge Visa 189. Upload Docs/Form 80.
    07/14/14 - Medicals @ SLEC Global.
    07/15/14 - Upload NBI. (NBI Valid until July 4, 2015).
    07/17/14 - CO Allocated. Team 7 GSM Adelaide ( CO : LM )
    07/21/14 - VISA GRANT! Thank You Lord! IED : 07/04/15
    02/06/15 - Hubby in Melbourne (Jobhunting)
    03/27/15 - Me and my son in Melbourne
    04/07/15 - Hubby 1st day of job
    08/24/15 - My 1st day in BP, Thank you Lord God Jesus!

    Enjoying the wonderful life in Oz, abundant blessings indeed :-)

  • johnvangiejohnvangie Melbourne
    Posts: 686Member
    Joined: Oct 14, 2013
    @manongko

    Sa www.domain.com.au, www.realestate.com.au.

    Hope to see you here in Melbourne soon!
    GOD Bless

    Nominated Occupation : Production or Plant Engineer 233513
    12/15/13 - IELTS IDP [ L : 9.0 I R :8.0 I S : 7.5 I W : 6.5 ]
    01/17/14 - Submit CDR to Engineers Australia.
    02/15/14 - IELTS IDP [ L : 9.0 I R :9.0 I S : 7.5 I W : 7.0 ]
    05/29/14 - EA positive assessment as Production or Plant Engineer 233513
    06/02/14 - EA Letter Received. Lodge EOI 65points.
    06/09/14 - Received invitation to lodge Visa 189.
    06/12/14 - Lodge Visa 189. Upload Docs/Form 80.
    07/14/14 - Medicals @ SLEC Global.
    07/15/14 - Upload NBI. (NBI Valid until July 4, 2015).
    07/17/14 - CO Allocated. Team 7 GSM Adelaide ( CO : LM )
    07/21/14 - VISA GRANT! Thank You Lord! IED : 07/04/15
    02/06/15 - Hubby in Melbourne (Jobhunting)
    03/27/15 - Me and my son in Melbourne
    04/07/15 - Hubby 1st day of job
    08/24/15 - My 1st day in BP, Thank you Lord God Jesus!

    Enjoying the wonderful life in Oz, abundant blessings indeed :-)

  • MsViMsVi Melbourne
    Posts: 69Member
    Joined: Sep 11, 2014
    @J_Oz mukhang tahimik ka lately bro ah..musta ang preps for the big move? :)

    07-23-2014 Submitted docs to ACS 2631111 (Computer Network and Systems Professional)
    08-02-2014 IELTS IDP exam
    08-15-2014 LRWS/6.5 (retake)
    08-18-2014 ACS result suitable Bachelors degree minor in computing (deducted 6yrs work exp)
    09-20-2014 IELTS IDP exam
    10-03-2014 LRWS result 8 8 6 7
    04-11-2015 PTE Academic 75 75 76 73
    04-13-2015 Submitted EOI 189
    05-08-2015 ITA received
    05-10-2015 Visa lodge
    05-25-2015 Medical at BGC
    07-02-2015 Direct visa grant (Thank you God!)

  • FuturesFutures Melbourne
    Posts: 140Member
    Joined: Apr 11, 2015
    @manongko, ayan nasagot na sa taas... search ka sa seek nga mga CE opening. Makita mo saang location marami... that's one thing i did in deciding na magMelby ako initially..

    06Dec14 : IELTS (R7 L7 W7 S6.5)
    12Feb15 : Queued for EA Assessment (BSEE)
    18Apr15 : IELTS Retake (R8.5 L7 W7.5 S7 +10!)
    05May15 : EA positive
    05May15 : Lodge EOI 65 points
    08May15 : Invited for 189
    23June15 : Submitted and paid by BPI Mastercard CC
    17Aug15 : CO assigned (Day 55)
    16Nov15 : Wife's early but successful delivery
    21Nov15 : Applied for baby's passport (RD: December 7)
    08Dec15 : Sent passport to CO
    05Jan16 : Received acknowledgement of additional dependent
    07Jan16 : Received HAP ID for baby's medicals
    09Jan16 : Medicals completed
    25Jan16 : All medical clearance provided
    23Feb16 : Thanks God!

    Preparing for April Big Move!

  • J_OzJ_Oz Sydney
    Posts: 1,002Member
    Joined: Jun 05, 2014
    @Filoz yes, kita kits, inggit ako sa EB nyo ng team april hehe

    Developer Programmer (261312)
    08.25.2014: Completed gathering of documents
    08.29.2014: ACS Skills Assessment
    09.09.2014: ACS Result - OK - Thank you Lord!
    10.18.2014: IELTS IDP Makati
    10.31.2014: IELTS- R:8.5 L:7.5 S:7 W:7 - OBS:7.5) - Thank you Lord!
    02.03.2015: Submitted EOI
    02.26.2015: Received ITA 189
    04.24.2015: Lodged Visa - Day 1
    04.25.2015: Uploaded docs - Day 2
    05.08.2015: Wife NBI Clearance - Day 15 || 05.25.2015: Uploaded NBI Clearance - Day 32
    05.28.2015: Medicals @ SLEC BGC Day 35
    05.30.2015: Medicals Finalised - Day 37
    06.11.2015: CO Allocated - Day 48
    07.02.2015 - Visa Granted! Thank you LORD! Glory to God!
    10.15.2015 - Arrived in SYD - Jer 29:11

  • J_OzJ_Oz Sydney
    Posts: 1,002Member
    Joined: Jun 05, 2014
    @MsVi Oo medyo nagpapakabusy sa work, ang hirap pala ng may visa grant na kasi ang hirap na magtrabaho. Araw-araw iniisip kung ano na ang susunod na gagawin hehe and yon mga possibleng mangyari :)

    Developer Programmer (261312)
    08.25.2014: Completed gathering of documents
    08.29.2014: ACS Skills Assessment
    09.09.2014: ACS Result - OK - Thank you Lord!
    10.18.2014: IELTS IDP Makati
    10.31.2014: IELTS- R:8.5 L:7.5 S:7 W:7 - OBS:7.5) - Thank you Lord!
    02.03.2015: Submitted EOI
    02.26.2015: Received ITA 189
    04.24.2015: Lodged Visa - Day 1
    04.25.2015: Uploaded docs - Day 2
    05.08.2015: Wife NBI Clearance - Day 15 || 05.25.2015: Uploaded NBI Clearance - Day 32
    05.28.2015: Medicals @ SLEC BGC Day 35
    05.30.2015: Medicals Finalised - Day 37
    06.11.2015: CO Allocated - Day 48
    07.02.2015 - Visa Granted! Thank you LORD! Glory to God!
    10.15.2015 - Arrived in SYD - Jer 29:11

  • FilozFiloz Melbourne
    Posts: 185Member
    Joined: Nov 08, 2012
    @johnvangie Hi po :) Thanks sa po sa pagwelcome hope to see you in Melby :) Sa Wonga Park po kami magstay. Thanks po sa isa natin kasamahan sa Pinoy AU na nadiscover po namin na nagoffer po pala sila BnB ;)

    Accountant (General): 221111
    Primary Applicant: Husband
    01/29/2013 - IELTS results L-8.5 R-8.0 W-8.0 S-9.0
    05/26/2014 - CPA AU Professional Title granted by CPA Australia
    06/02/2014 - Submitted and paid CPAA Migration Assessment
    07/04/2014 - Assessment by CPAA 11/12 (Questioning about Accounting Theory)
    08/04/2014 - Sent Appeal Letter with all the supporting Documents to CPAA
    08/29/2014 - Received Complete CPAA Assessment Result 12/12 (Academically Suitable for Migration)
    12/12/2014 - Received CPAA Skilled Employment Assessment
    03/26/2015 - Submitted EOI for 189 (75pts)
    03/27/2015 - Invited to apply Visa 189
    04/06/2015 - Lodged Visa 189
    05/02/2015 - Medicals at Gulf X-ray and Laboratories Doha
    05/06/2015 - Medicals Uploaded
    05/12/2015 - Received NBI from Representative in PH. Uploaded NBI
    05/18/2015 - CO Allocated. Same day Uploaded additional Docs.
    05/22/2015 - Received Delay Email
    07/02/2015 - VISA GRANT! Thank you Lord!
    08/21/2015 - Initial Entry Completed (Melbourne)
    May 2016 - Husband got a Job Offer
    June 2016 - Big Move Melbourne

    All for the Greater Glory of GOD!!!
    Proverbs 16:3 Commit your work to the Lord, and your plans will be established.

  • FilozFiloz Melbourne
    Posts: 185Member
    Joined: Nov 08, 2012
    @J_Oz Hehehe excited na nga ako makaEB ang Team April na mga tiga Melby :) Pero dapat bro ituloy natin ang Mega EB natin lahat na Team April next year kapag lahat na tayo nakalipat for good sa Aussie ;) Saan kaya tayo magmeet nun lahat may Tiga Sydney, Melbourne, Canberra and Perth hehehe sa Gold Coast? :P

    Accountant (General): 221111
    Primary Applicant: Husband
    01/29/2013 - IELTS results L-8.5 R-8.0 W-8.0 S-9.0
    05/26/2014 - CPA AU Professional Title granted by CPA Australia
    06/02/2014 - Submitted and paid CPAA Migration Assessment
    07/04/2014 - Assessment by CPAA 11/12 (Questioning about Accounting Theory)
    08/04/2014 - Sent Appeal Letter with all the supporting Documents to CPAA
    08/29/2014 - Received Complete CPAA Assessment Result 12/12 (Academically Suitable for Migration)
    12/12/2014 - Received CPAA Skilled Employment Assessment
    03/26/2015 - Submitted EOI for 189 (75pts)
    03/27/2015 - Invited to apply Visa 189
    04/06/2015 - Lodged Visa 189
    05/02/2015 - Medicals at Gulf X-ray and Laboratories Doha
    05/06/2015 - Medicals Uploaded
    05/12/2015 - Received NBI from Representative in PH. Uploaded NBI
    05/18/2015 - CO Allocated. Same day Uploaded additional Docs.
    05/22/2015 - Received Delay Email
    07/02/2015 - VISA GRANT! Thank you Lord!
    08/21/2015 - Initial Entry Completed (Melbourne)
    May 2016 - Husband got a Job Offer
    June 2016 - Big Move Melbourne

    All for the Greater Glory of GOD!!!
    Proverbs 16:3 Commit your work to the Lord, and your plans will be established.

  • J_OzJ_Oz Sydney
    Posts: 1,002Member
    Joined: Jun 05, 2014
    @J_Oz Hehehe excited na nga ako makaEB ang Team April na mga tiga Melby :) Pero dapat bro ituloy natin ang Mega EB natin lahat na Team April next year kapag lahat na tayo nakalipat for good sa Aussie ;) Saan kaya tayo magmeet nun lahat may Tiga Sydney, Melbourne, Canberra and Perth hehehe sa Gold Coast? :P
    Haha Oo sana kami matuloy na this year para makapagipon na rin for Aus Open hehe. at sa mega Eb natin, naisip ko para fair e either Darwin or Hobart haha

    Developer Programmer (261312)
    08.25.2014: Completed gathering of documents
    08.29.2014: ACS Skills Assessment
    09.09.2014: ACS Result - OK - Thank you Lord!
    10.18.2014: IELTS IDP Makati
    10.31.2014: IELTS- R:8.5 L:7.5 S:7 W:7 - OBS:7.5) - Thank you Lord!
    02.03.2015: Submitted EOI
    02.26.2015: Received ITA 189
    04.24.2015: Lodged Visa - Day 1
    04.25.2015: Uploaded docs - Day 2
    05.08.2015: Wife NBI Clearance - Day 15 || 05.25.2015: Uploaded NBI Clearance - Day 32
    05.28.2015: Medicals @ SLEC BGC Day 35
    05.30.2015: Medicals Finalised - Day 37
    06.11.2015: CO Allocated - Day 48
    07.02.2015 - Visa Granted! Thank you LORD! Glory to God!
    10.15.2015 - Arrived in SYD - Jer 29:11

  • FilozFiloz Melbourne
    Posts: 185Member
    Joined: Nov 08, 2012
    @J_Oz Oo nga ako naman inggitin ninyo lahat kasi mag EB kayong lahat ulit sa AU Open magiipon na ang mga tiga Sydney, Perth and Canberra for January. Kung pwede lang sana magpaiwan na ako hehehe. Nice yan Bro Down down under Hobart para maiba :P

    Accountant (General): 221111
    Primary Applicant: Husband
    01/29/2013 - IELTS results L-8.5 R-8.0 W-8.0 S-9.0
    05/26/2014 - CPA AU Professional Title granted by CPA Australia
    06/02/2014 - Submitted and paid CPAA Migration Assessment
    07/04/2014 - Assessment by CPAA 11/12 (Questioning about Accounting Theory)
    08/04/2014 - Sent Appeal Letter with all the supporting Documents to CPAA
    08/29/2014 - Received Complete CPAA Assessment Result 12/12 (Academically Suitable for Migration)
    12/12/2014 - Received CPAA Skilled Employment Assessment
    03/26/2015 - Submitted EOI for 189 (75pts)
    03/27/2015 - Invited to apply Visa 189
    04/06/2015 - Lodged Visa 189
    05/02/2015 - Medicals at Gulf X-ray and Laboratories Doha
    05/06/2015 - Medicals Uploaded
    05/12/2015 - Received NBI from Representative in PH. Uploaded NBI
    05/18/2015 - CO Allocated. Same day Uploaded additional Docs.
    05/22/2015 - Received Delay Email
    07/02/2015 - VISA GRANT! Thank you Lord!
    08/21/2015 - Initial Entry Completed (Melbourne)
    May 2016 - Husband got a Job Offer
    June 2016 - Big Move Melbourne

    All for the Greater Glory of GOD!!!
    Proverbs 16:3 Commit your work to the Lord, and your plans will be established.

  • FilozFiloz Melbourne
    Posts: 185Member
    Joined: Nov 08, 2012
    Sharing lang po. Initial Entry Completed last August 21. Napakaganda po ng Melbourne :) Napakaganda din po ng vibe ng mga tao at hindi na gaanu malamig ang panahon ngayon dahil malapit na ang spring. Masaya kami sa tinuluyan namin dito sa Wonga Park. Thank you sa isa natin kasama dito sa Pinoy Au na nagpaparent for short stay. Napakaccomodating po ng host namin at we felt at home agad and we highly recommend them. You can feel one with nature, safe and tahimik ang suburb, country feeling nakakarelax madidinig ang mga huni ng ibon sa bakuran and mararamdaman mo ang ganda ng vibe ng mga tao lalo na kanina sa mass sa chuch ng Sacred Heart sa Croydon mararamdaman mo that you are one with the community. We have until Friday to explore Melbourne, ayusin ang tfn, bank and medicare, meet friends and pinoy au friends. Napakaganda gawin motivation ulit ng makita namin ang ganda ng Melbourne sa pagiipon at pagahhanda for big move next year. We really felt na sobrang blessed nating lahat, given the opportunity to live in this amazing country which has so much to offer. Kitakits mga Melby Mates! :) :) :) Cheers!

    KUDOS po sa mga kapatid natin dito ng Pinoy Au na nag guide and nagbibigay ng tips sa mga baguhan sa Melbourne. :) :) :)

    Accountant (General): 221111
    Primary Applicant: Husband
    01/29/2013 - IELTS results L-8.5 R-8.0 W-8.0 S-9.0
    05/26/2014 - CPA AU Professional Title granted by CPA Australia
    06/02/2014 - Submitted and paid CPAA Migration Assessment
    07/04/2014 - Assessment by CPAA 11/12 (Questioning about Accounting Theory)
    08/04/2014 - Sent Appeal Letter with all the supporting Documents to CPAA
    08/29/2014 - Received Complete CPAA Assessment Result 12/12 (Academically Suitable for Migration)
    12/12/2014 - Received CPAA Skilled Employment Assessment
    03/26/2015 - Submitted EOI for 189 (75pts)
    03/27/2015 - Invited to apply Visa 189
    04/06/2015 - Lodged Visa 189
    05/02/2015 - Medicals at Gulf X-ray and Laboratories Doha
    05/06/2015 - Medicals Uploaded
    05/12/2015 - Received NBI from Representative in PH. Uploaded NBI
    05/18/2015 - CO Allocated. Same day Uploaded additional Docs.
    05/22/2015 - Received Delay Email
    07/02/2015 - VISA GRANT! Thank you Lord!
    08/21/2015 - Initial Entry Completed (Melbourne)
    May 2016 - Husband got a Job Offer
    June 2016 - Big Move Melbourne

    All for the Greater Glory of GOD!!!
    Proverbs 16:3 Commit your work to the Lord, and your plans will be established.

  • J_OzJ_Oz Sydney
    Posts: 1,002Member
    Joined: Jun 05, 2014
    @Filoz sobrang aliw kami kapag nakikita namin post mo sa fb. :) pakiramdam namin andyan rin kami. And sobrang iba talaga kapag ang matuluyan eh member ng pinoy au hihi. ;)

    More posts ate @filoz ha. Enjoy your stay there. Kamusta sa ating mga kababayan dyan and to your lovely hosts haha. Feeling close lang haha

    Developer Programmer (261312)
    08.25.2014: Completed gathering of documents
    08.29.2014: ACS Skills Assessment
    09.09.2014: ACS Result - OK - Thank you Lord!
    10.18.2014: IELTS IDP Makati
    10.31.2014: IELTS- R:8.5 L:7.5 S:7 W:7 - OBS:7.5) - Thank you Lord!
    02.03.2015: Submitted EOI
    02.26.2015: Received ITA 189
    04.24.2015: Lodged Visa - Day 1
    04.25.2015: Uploaded docs - Day 2
    05.08.2015: Wife NBI Clearance - Day 15 || 05.25.2015: Uploaded NBI Clearance - Day 32
    05.28.2015: Medicals @ SLEC BGC Day 35
    05.30.2015: Medicals Finalised - Day 37
    06.11.2015: CO Allocated - Day 48
    07.02.2015 - Visa Granted! Thank you LORD! Glory to God!
    10.15.2015 - Arrived in SYD - Jer 29:11

  • MsViMsVi Melbourne
    Posts: 69Member
    Joined: Sep 11, 2014
    Hello everyone, I just have a question and hope someone can confirm..I'm the primary applicant with my son based here in PH..my husband is based in Dubai and we intend to do our initial entry by December..most probably mauuna kami ng son ko ng mga few days and my husband will be arriving in Melby from Dubai..wala po bang magiging problema kung di kami sabay dumating ng Melbourne? tia :)

    07-23-2014 Submitted docs to ACS 2631111 (Computer Network and Systems Professional)
    08-02-2014 IELTS IDP exam
    08-15-2014 LRWS/6.5 (retake)
    08-18-2014 ACS result suitable Bachelors degree minor in computing (deducted 6yrs work exp)
    09-20-2014 IELTS IDP exam
    10-03-2014 LRWS result 8 8 6 7
    04-11-2015 PTE Academic 75 75 76 73
    04-13-2015 Submitted EOI 189
    05-08-2015 ITA received
    05-10-2015 Visa lodge
    05-25-2015 Medical at BGC
    07-02-2015 Direct visa grant (Thank you God!)

  • TasBurrfootTasBurrfoot Osaka
    Posts: 4,336Member
    Joined: Feb 24, 2011
    Hello everyone, I just have a question and hope someone can confirm..I'm the primary applicant with my son based here in PH..my husband is based in Dubai and we intend to do our initial entry by December..most probably mauuna kami ng son ko ng mga few days and my husband will be arriving in Melby from Dubai..wala po bang magiging problema kung di kami sabay dumating ng Melbourne? tia :)
    there shouldn't be...

    Primary Applicant: Wife
    Accountant (General): 221111

    04 Aug 2012 - IELTS (Academic Module)
    07 Aug 2012 - IELTS (Academic Module) Speaking Part
    17 Aug 2012 - IELTS Results (L: 8.5 R: 8.5 W: 7.0 S: 7.5 OBS: 8.0)
    24 Aug 2012 - CPAA Submitted (docs mailed same day via SG EMS)
    25 Sep 2012 - Received +Skills Assessment from CPAA
    25 Sep 2012 - Lodged EOI Application with 70pts
    30 Sep 2012 - Invited by DIAC to apply for 189 Visa
    01 Oct 2012 - Submitted 189 Visa Application
    20 Oct 2012 - Medical Examinations
    23 Oct 2012 - CO Assigned; Team 7 - SA
    05 Nov 2012 - Submitted SG PCC and NBI Clearance
    06 Nov 2012 - Visa Granted (IED: 23/10/2013)
    03 Apr 2013 - Flight to MEL
    03 Jun 2013 - started work
    12 Jun 2013 - wife started work
    15 Jun 2016 - applied for citizenship
    29 Jul 2016 - citizenship examination
    20 Oct 2016 - Aussie, Aussie, Aussie Oi Oi Oi!!

  • FilozFiloz Melbourne
    Posts: 185Member
    Joined: Nov 08, 2012
    @Filoz sobrang aliw kami kapag nakikita namin post mo sa fb. :) pakiramdam namin andyan rin kami. And sobrang iba talaga kapag ang matuluyan eh member ng pinoy au hihi. ;)

    More posts ate @filoz ha. Enjoy your stay there. Kamusta sa ating mga kababayan dyan and to your lovely hosts haha. Feeling close lang haha
    Hehehe pangmotivate ang mga pics sa mga friends sa fb na galing sa Pinoy AU :) Para mas maging masigasig tayong lahat at huwag sumuko sa mga pangarap. Konting kembot nalang ;) Hayaan mo bro makakarating sa aking lovely host hehehe. Refer kita kapag dito ka sa Melby tutuloy. ;)

    Looking forward to see you and your wifey soon mate! :)

    Accountant (General): 221111
    Primary Applicant: Husband
    01/29/2013 - IELTS results L-8.5 R-8.0 W-8.0 S-9.0
    05/26/2014 - CPA AU Professional Title granted by CPA Australia
    06/02/2014 - Submitted and paid CPAA Migration Assessment
    07/04/2014 - Assessment by CPAA 11/12 (Questioning about Accounting Theory)
    08/04/2014 - Sent Appeal Letter with all the supporting Documents to CPAA
    08/29/2014 - Received Complete CPAA Assessment Result 12/12 (Academically Suitable for Migration)
    12/12/2014 - Received CPAA Skilled Employment Assessment
    03/26/2015 - Submitted EOI for 189 (75pts)
    03/27/2015 - Invited to apply Visa 189
    04/06/2015 - Lodged Visa 189
    05/02/2015 - Medicals at Gulf X-ray and Laboratories Doha
    05/06/2015 - Medicals Uploaded
    05/12/2015 - Received NBI from Representative in PH. Uploaded NBI
    05/18/2015 - CO Allocated. Same day Uploaded additional Docs.
    05/22/2015 - Received Delay Email
    07/02/2015 - VISA GRANT! Thank you Lord!
    08/21/2015 - Initial Entry Completed (Melbourne)
    May 2016 - Husband got a Job Offer
    June 2016 - Big Move Melbourne

    All for the Greater Glory of GOD!!!
    Proverbs 16:3 Commit your work to the Lord, and your plans will be established.

  • ImBImB Melbourne
    Posts: 284Member
    Joined: Nov 10, 2013
    @Filoz sobrang aliw kami kapag nakikita namin post mo sa fb. :) pakiramdam namin andyan rin kami. And sobrang iba talaga kapag ang matuluyan eh member ng pinoy au hihi. ;)

    More posts ate @filoz ha. Enjoy your stay there. Kamusta sa ating mga kababayan dyan and to your lovely hosts haha. Feeling close lang haha
    Aba ang team April eh nasa Melby na pala hehe.

    @J_Oz kumusta? Agree agree. Napakaganda pala ng Melbourne.

    Dati once a once a month lang ako magcheck ng FB ngayon eh napapadalas dahil ke @filoz.

    @Filoz, ok yan break muna kayo sa init ng ME, kami dito ngayon eh basa lagi kili kili haha. Post ka lang ng mga experiences nyo dyan :)

    External Auditor
    October 2013 - IELTS review started
    November 2013 - Acad IELTS exam (Failed)
    February 2014 - Acad IELTS exam (Passed)
    1 September 2014 - Sent docs to CPA Australia
    15 September 2014 - CPAA requested other information
    18 September 2014 - Sent additional information to CPAA
    1 October 2014 - Received positive skills assessment from CPAA
    1 October 2014 - CPAA requested additional documents for employment assessment
    12 January 2015 - Received employment assessment from CPAA
    12 January 2015 - Requested a review of employment assessment made by CPAA
    1 February 2015 - EOI filed, 60 points
    5 February 2015 - Received amended employment assessment from CPAA (increased work experience)
    5 February 2015 - EOI updated, 65 points
    13 February 2015 - Received invitation to lodge visa
    17 February 2015 - Lodge and paid visa 189
    9 April 2015 - CO allocated (Team Adelaide)
    ................... - Waited for baby to come :)
    17 June 2015 - Sent baby's documents
    1 July 2015 - Uploaded form 80, NBI, Medicals
    8 July 2015 - Visa Grant!! :)
    x January 2016 - Arrived in AU
    x July 2016 - Accepted a Contractor Job
    x October 2016 - Made Permanent

  • persephone30persephone30 Los Angeles
    Posts: 162Member
    Joined: Jan 21, 2014
    edited August 2015
    Hi @Filoz... thanks for sharing!Nakaka excite naman yung post mo. Malapit na din kasi ang initial entry namin and tinatry ko wag ma excite masyado haha baka di nako makatulog. Btw, kamusta po ang lamig?Need pa rin ba magdala ng thick jackets, o light jackets will do na? Or di na need mag jacket?hehe medyo concern din kasi namin ang lamig.

    Tsaka sa tfn and medicare, ok lng ba iprocess na now kahit next yr pa mag big move?Di ba need yun ng address and need i declare tax for savings acct? Parang may nabasa ako tinatax daw yung savings dunno kung totoo eto :S Balak ko din iprocess na sana ang tfn and medicare pero dami nag advise na wag muna kung di pa naman mag permanently move.

    Computer Network and Systems Engineer
    Jan. 2014 - Decided to finally pursue AU Immigration
    Feb. 9, 2014 - Applied for ACS Assessment
    Mar.15, 2014 - Took IELTS Exam @IDP
    Mar. 28, 2014 - IELTS Score: L:8.5; R:9.0; S:7.0; W:6.5
    Apr. 2, 2014 - Applied for remarking
    Apr. 16, 2014 - ACS result suitable
    May 17, 2014 - Retake IELTS @IDP
    May 30, 2014 - IELTS Score: L:8.0; R:9.0; S:7.0; W:7.0
    June 10, 2014 - IELTS Remarking successful! (New IELTS Score: L:8.5; R:9.0; S:7.0; W:7.0)
    June 14, 2014 - Submitted EOI & VIC SS
    June 17, 2014 - updated EOI to uncheck Visa 189 and include Mom as dependent; VIC confirmed Mom is added as dependent.
    Oct. 06,2014 - VIC SS Successful; Invited for Visa 190. Submitted My Health Declaration
    Oct. 15, 2014 - Mom & Baby Medicals @ Cebu Doctor's
    Nov. 11, 2014 - My Medical done at Point Medical
    Nov. 20, 2014 - Requested NBI again via Ms. Sandra
    Nov. 21, 2014 - Lodged Visa 190
    Nov. 25, 2014 - Requested SG PCC
    Dec. 03, 2014 - Received NBI Clearance
    Dec. 04, 2014 - emailed VIC of TRN and status of application
    Dec. 05, 2014 - Collected SG PCC
    Jan. 06, 2015 - Direct Grant! Thank you God!!! GSM Brisbane - Team 33 (IED: Oct 21, 2015)

Sign In or Register to comment.
LATEST 10 ACTIVE DISCUSSION THREAD
angel_iq4

Melbourne or Sydney

most recent by Admin

angel_iq4
angel_iq4

Gamer?

most recent by smashromasa

angel_iq4

BIG MOVE

most recent by charls059

Welcome to Pinoy AU Community!

The longest running Pinoy-Australian Forum site in the history. We are connecting Pinoys "in" and "to" Australia since 2010! If you want to join in, click one of these buttons!

Categories

Random Members
(56596)

greamreaper24jackmart2bruce22tzailyrammurilloJustin32Chuy92mikelachica777morganccemmancpparkerkhanwenggaygaynildaUme_HaiderMichierose85thelostStark01flintandstnesJanelinejosephjcarewise
Browse Members

Members Online (0) + Guest (102)

Top Posters

  • No Posting Yet

Top Active Contributors

Top Posters

🚀 We’re Upgrading the Mothership!

Our site is moving to a shiny new platform.
The engines are warming up, the crew is busy, and it may take a little while ⏳.

Sit tight, we’ll be back better, faster, and cooler than ever. 🌌